Identifiers and Description

Gene Model Identifier

TTHERM_00049080

Standard Name

POB3 (POl1 Binding)

Aliases

PreTt11287 | 3.m01985 | 3824.m03045 | Ssrp1

Description

Structure-specific recognition protein (Ssrp1). Interacts with Spt16 (Cet1) as a component of the FACT-complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00049080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01649.19.997093137033517e-262structure-specific recognition
protein (437 aa)
OxytrichaContig22582.0.g1046.001629673589058e-65Structure-specific recognition
protein (SSRP1)
SGDYML069W2.999948199478294e-54POB3 Subunit of the heterodime
ric FACT complex (Spt16p-Pob3p
), which associates with chrom
atin via interaction with Nhp6
Ap and Nhp6Bp, and reorganizes
nucleosomes to facilitate acc
ess to DNA by RNA and DNA poly
merases
WormBaseWBGene000019743.998479955315009e-46locus:hmg-4 FACT complex sub
unit SSRP1-A status:Confirme
d UniProt:P41848 protein_i
d:CCD69078.1
DictyBaseDDB_G02903313.998777993244535e-41ssrp1 on chromosome: 5 positio
n 3969916 to 3971699
Stentor CoeruleusSteCoe_359671.462486227251231e-31

General Information

Paragraph NoGene NameParagraph Text
129POB3The FACT-complex is a critical transcription regulator and an H2A/H2B chaperone. Affinity purification followed by mass spectrometry (AP-MS) of endogenously tagged T. thermophila histones H2A/H2B identified Cet1 and Pob3 subunits of the FACT complex as high-confidence interacting partners. Indirect immunofluorescence studies using endogenously tagged Cet1 indicated that it localized to both the MAC and MIC during vegetative growth. AP-MS analysis using Tetrahymena Cet1 as a bait protein revealed Pob3 and subunits of RNA polymerase as high-confidence co-purifying proteins.

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00049080(coding)
ATGAGTGATAGGTGTTATAAAGGTGTCAACTGGGGTAATGTTACCTTTGAAGATGACTAA
TTAGTCCTTAGTCATAACAAGAGAAGATTGTGCAAACTTTCTTTAAAGAAATTCACAAAC
TCTACTGTTAACAAAACTGATATTGTAATTGATTTGAACACAGTTGATCTTCAAGATGAT
GAAGACTAACTCTGTGAAATGAGATTATTTATTCCTCAATAATAAGACGCTTAAATGAAA
CCTGAAGATGATGGAGAAGGTGAAGAAAAAGAAGGTGAAGATAGCGTAGGTGGATATGCA
GATTAACTTAACTCTGAAATTATTACTAAAGCTAAAATTGGCTAATACTCTGGTTAATCA
ATAGTTAAATTCGAAGACATATCACTTCTTGTTCCTAGAGGTAAATACCAACTTGATATG
TACAAAAAAACAGTAAGATTCCACGGCTCTTCTTTTAACTATATAGTAGAATATAGTAAT
GTTATTAAGGGCTTCCTCCTTCCTCAACCTGACGAAGTACATGTTGCTTTCGTTCTTGGT
TTAGATTAACCCTTAAAAATTGGTAATACTGTTCACTCTTACATAGTTATGCAATTCAAA
AAAGAACAAAAGGCTAACATCAAAGTAAACATTGATCCTGAAGAAAAGAAGGAAGATAAA
TTAAAGGATCTCGATGAAGAATATGATGGATTCTTATATGAAATTGCTGGTTAATTGTTT
AAAACTTTATGTAATAATGTATAAATCATCATGCCTGCTGGTTTCTAAAGCTCTGATAAG
TAAAATTGCTTGAAATGTACCCTTAAAACTCACCAAGGTCTTTTATATCCTATGAGAAAG
AGTTTGATCTTTATATATAAACCTGTAATTCACATATAAATCAGTGATATTTAAAAGGTC
GAATTTAATAGAGTTGGTAATGCTACTCTGAATAAATTGTTTGATGTCAAAGTATTTACT
AAGACCACAACCCCTCAATTCTTTGGTTTTGAAAGAAAGGAATTAGATGTCCTCTTAGAA
TACTTTAAATCTAAAAATATTAAGATTACATATGATGATACTAATTAAGGAGCCACTTTT
GATGATGAGGATGAGGAATTCACAGACTCTATTTCTGAAGATGAGGAAGAAGGTAAGAGA
GCTCAAAGAAAGAGTGCTAAGAGAGCTAATAAAGCAGTAAAAGGATAATCAGGATTACCC
CTTGACGATGATGACGAAGAAGAAGACGAAGACTTTGATGCTGATGAATTTGAAAGTGAA
GATGATGAGGAAGAGGAAGAAGACGAAGATGAAGATGAAGATTTTGAATAATGA


>TTHERM_00049080(protein)
MSDRCYKGVNWGNVTFEDDQLVLSHNKRRLCKLSLKKFTNSTVNKTDIVIDLNTVDLQDD
EDQLCEMRLFIPQQQDAQMKPEDDGEGEEKEGEDSVGGYADQLNSEIITKAKIGQYSGQS
IVKFEDISLLVPRGKYQLDMYKKTVRFHGSSFNYIVEYSNVIKGFLLPQPDEVHVAFVLG
LDQPLKIGNTVHSYIVMQFKKEQKANIKVNIDPEEKKEDKLKDLDEEYDGFLYEIAGQLF
KTLCNNVQIIMPAGFQSSDKQNCLKCTLKTHQGLLYPMRKSLIFIYKPVIHIQISDIQKV
EFNRVGNATLNKLFDVKVFTKTTTPQFFGFERKELDVLLEYFKSKNIKITYDDTNQGATF
DDEDEEFTDSISEDEEEGKRAQRKSAKRANKAVKGQSGLPLDDDDEEEDEDFDADEFESE
DDEEEEEDEDEDEDFEQ


>TTHERM_00049080(gene)
ATGAGTGATAGGTGTTATAAAGGTGTCAACTGGGGTAATGTTACCTTTGAAGATGACTAA
TTAGTCCTTAGTCATAACAAGAGAAGATTGTGCAAACTTTCTTTAAAGAAATTCACAAAC
TCTACTGTTAACAAAACTGATATTGTAATTGATTTGAACACAGTTGATCTTCAAGATGAG
TATCTTCATTTTTTTATTTTCCTCTAGATAGAAAAAAGATTCAAAAAATGTTTATTTTTA
CTTCAATTTTTGAAAAATAATGAATAAATTTACACAGAAAAGCCATTTTAGCTAATATTT
TATGCATATAATTATAGTGAAGACTAACTCTGTGAAATGAGATTATTTATTCCTCAATAA
TAAGACGCTGTAAAAATTAGTATTTAGTTAATGTAATTTTCTCAAAAACAATGTATTAAT
TCAAAAGTAAATGAAACCTGAAGATGATGGAGAAGGTGAAGAAAAAGAAGGTGAAGATAG
CGTAGGTGGATATGCAGATTAACTTAACTCTGAAATTATTACTAAAGCTAAAATTGGCTA
ATACTCTGGTTAATCAATAGTTAAATTCGAAGACATATCACTTCTTGTTCCTAGGTAAAT
TTTAAAACAAATTATCTAATTAGCTTCACATGCATTATGTTATACCACTTCCTAGGCCCA
ATAATATAAAATAATAAGTTTAAAAGTTTAAACATTATGAAAAATTGGCGAATAGTTTGC
TTAGAAGTTATAGCATTTTTTATATATATAAAATAATATGTCTATATTAAGAAATAGGAT
TATGACAAAATTTTAGCAGACTTTATTTAAATCTTAAAATTTTATAAATATAATAGAGGT
AAATACCAACTTGATATGTACAAAAAAACAGTAAGATTCCACGGCTCTTCTTTTAACTAT
ATAGTAGAATATAGTAATGTTATTAAGGGCTTCCTCCTTCCTCAACCTGACGAAGTAAGA
AGATTAAAAAGAGTTATAAGACAATTATAAATCATATTTTAAAAAAGGTACATGTTGCTT
TCGTTCTTGGTTTAGATTAACCCTTAAAAATTGGTAATACTGTTCACTCTTACATAGTTA
TGCAATTCAAAAAAGAACAAAAGGCTAACATCAAAGTAAACATTGATCCTGAAGAAAAGA
AGGAAGATAAATTAAAGGATCTCGATGAAGAATATGATGGATTCTTATATGAAATTGCTG
GTTAATTGTTTAAAACTTTATGTAATAATGTATAAATCATCATGCCTGCTGGTTTCTAAA
GGTAAACAATTAATTTTTTATTTTAGTTGAGTTAAATATAATTTAATAAATAACTAGCTC
TGATAAGTAAAATTGCTTGAAATGTACCCTTAAAACTCACCAAGGTCTTTTATATCCTAT
GAGAAAGAGTTTGATCTTTATATATAAACCTGTAATTCACATATAAATCAGTGATATTTA
AAAGGTCGAATTTAATAGAGTAAAATGAAATTTTTTGTCTAGAAATATTTTATTGAACAA
TTTGCCAAATAATAAAAAAAAATAGGTTGGTAATGCTACTCTGAATAAATTGTTTGATGT
CAAAGTATTTACTAAGACCACAACCCCTCAATTCTTTGGTTTTGAAAGAAAGGAATTAGA
TGTCCTCTTAGAATACTTTAAATCTAAAAATATTAAGATTACATATGATGATACTAATTA
AGGAGCCACTTTTGATGATGAGGATGAGGAATTCACAGACTCTATTTCTGAAGATGAGGA
AGAAGTATAATTTATCTTTTTATTTATTTCTGATAAAAATTTATATTGTAATTAAAGGGT
AAGAGAGCTCAAAGAAAGAGTGCTAAGAGAGCTAATAAAGCAGTAAAAGGATAATCAGGA
TTACCCCTTGACGATGATGACGAAGAAGAAGACGAAGACTTTGATGCTGATGAATTTGAA
AGTGAAGATGATGAGGAAGAGGAAGAAGACGAAGATGAAGATGAAGATTTTGAATAATGA