Identifiers and Description

Gene Model Identifier

TTHERM_00049080

Standard Name

POB3 (POl1 Binding)

Aliases

PreTt11287 | 3.m01985 | 3824.m03045

Description

Structure-specific recognition protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00049080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01649.19.997093137033517e-262structure-specific recognition
protein (437 aa)
OxytrichaContig22582.0.g1046.001629673589058e-65Structure-specific recognition
protein (SSRP1)
SGDYML069W2.999948199478294e-54POB3 Subunit of the heterodime
ric FACT complex (Spt16p-Pob3p
), which associates with chrom
atin via interaction with Nhp6
Ap and Nhp6Bp, and reorganizes
nucleosomes to facilitate acc
ess to DNA by RNA and DNA poly
merases
WormBaseWBGene000019743.998479955315009e-46locus:hmg-4 FACT complex sub
unit SSRP1-A status:Confirme
d UniProt:P41848 protein_i
d:CCD69078.1
DictyBaseDDB_G02903313.998777993244535e-41ssrp1 on chromosome: 5 positio
n 3969916 to 3971699
Stentor CoeruleusSteCoe_359671.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00049080(coding)
ATGAGTGATAGGTGTTATAAAGGTGTCAACTGGGGTAATGTTACCTTTGAAGATGACTAA
TTAGTCCTTAGTCATAACAAGAGAAGATTGTGCAAACTTTCTTTAAAGAAATTCACAAAC
TCTACTGTTAACAAAACTGATATTGTAATTGATTTGAACACAGTTGATCTTCAAGATGAT
GAAGACTAACTCTGTGAAATGAGATTATTTATTCCTCAATAATAAGACGCTTAAATGAAA
CCTGAAGATGATGGAGAAGGTGAAGAAAAAGAAGGTGAAGATAGCGTAGGTGGATATGCA
GATTAACTTAACTCTGAAATTATTACTAAAGCTAAAATTGGCTAATACTCTGGTTAATCA
ATAGTTAAATTCGAAGACATATCACTTCTTGTTCCTAGAGGTAAATACCAACTTGATATG
TACAAAAAAACAGTAAGATTCCACGGCTCTTCTTTTAACTATATAGTAGAATATAGTAAT
GTTATTAAGGGCTTCCTCCTTCCTCAACCTGACGAAGTACATGTTGCTTTCGTTCTTGGT
TTAGATTAACCCTTAAAAATTGGTAATACTGTTCACTCTTACATAGTTATGCAATTCAAA
AAAGAACAAAAGGCTAACATCAAAGTAAACATTGATCCTGAAGAAAAGAAGGAAGATAAA
TTAAAGGATCTCGATGAAGAATATGATGGATTCTTATATGAAATTGCTGGTTAATTGTTT
AAAACTTTATGTAATAATGTATAAATCATCATGCCTGCTGGTTTCTAAAGCTCTGATAAG
TAAAATTGCTTGAAATGTACCCTTAAAACTCACCAAGGTCTTTTATATCCTATGAGAAAG
AGTTTGATCTTTATATATAAACCTGTAATTCACATATAAATCAGTGATATTTAAAAGGTC
GAATTTAATAGAGTTGGTAATGCTACTCTGAATAAATTGTTTGATGTCAAAGTATTTACT
AAGACCACAACCCCTCAATTCTTTGGTTTTGAAAGAAAGGAATTAGATGTCCTCTTAGAA
TACTTTAAATCTAAAAATATTAAGATTACATATGATGATACTAATTAAGGAGCCACTTTT
GATGATGAGGATGAGGAATTCACAGACTCTATTTCTGAAGATGAGGAAGAAGGTAAGAGA
GCTCAAAGAAAGAGTGCTAAGAGAGCTAATAAAGCAGTAAAAGGATAATCAGGATTACCC
CTTGACGATGATGACGAAGAAGAAGACGAAGACTTTGATGCTGATGAATTTGAAAGTGAA
GATGATGAGGAAGAGGAAGAAGACGAAGATGAAGATGAAGATTTTGAATAATGA


>TTHERM_00049080(protein)
MSDRCYKGVNWGNVTFEDDQLVLSHNKRRLCKLSLKKFTNSTVNKTDIVIDLNTVDLQDD
EDQLCEMRLFIPQQQDAQMKPEDDGEGEEKEGEDSVGGYADQLNSEIITKAKIGQYSGQS
IVKFEDISLLVPRGKYQLDMYKKTVRFHGSSFNYIVEYSNVIKGFLLPQPDEVHVAFVLG
LDQPLKIGNTVHSYIVMQFKKEQKANIKVNIDPEEKKEDKLKDLDEEYDGFLYEIAGQLF
KTLCNNVQIIMPAGFQSSDKQNCLKCTLKTHQGLLYPMRKSLIFIYKPVIHIQISDIQKV
EFNRVGNATLNKLFDVKVFTKTTTPQFFGFERKELDVLLEYFKSKNIKITYDDTNQGATF
DDEDEEFTDSISEDEEEGKRAQRKSAKRANKAVKGQSGLPLDDDDEEEDEDFDADEFESE
DDEEEEEDEDEDEDFEQ


>TTHERM_00049080(gene)
ATGAGTGATAGGTGTTATAAAGGTGTCAACTGGGGTAATGTTACCTTTGAAGATGACTAA
TTAGTCCTTAGTCATAACAAGAGAAGATTGTGCAAACTTTCTTTAAAGAAATTCACAAAC
TCTACTGTTAACAAAACTGATATTGTAATTGATTTGAACACAGTTGATCTTCAAGATGAG
TATCTTCATTTTTTTATTTTCCTCTAGATAGAAAAAAGATTCAAAAAATGTTTATTTTTA
CTTCAATTTTTGAAAAATAATGAATAAATTTACACAGAAAAGCCATTTTAGCTAATATTT
TATGCATATAATTATAGTGAAGACTAACTCTGTGAAATGAGATTATTTATTCCTCAATAA
TAAGACGCTGTAAAAATTAGTATTTAGTTAATGTAATTTTCTCAAAAACAATGTATTAAT
TCAAAAGTAAATGAAACCTGAAGATGATGGAGAAGGTGAAGAAAAAGAAGGTGAAGATAG
CGTAGGTGGATATGCAGATTAACTTAACTCTGAAATTATTACTAAAGCTAAAATTGGCTA
ATACTCTGGTTAATCAATAGTTAAATTCGAAGACATATCACTTCTTGTTCCTAGGTAAAT
TTTAAAACAAATTATCTAATTAGCTTCACATGCATTATGTTATACCACTTCCTAGGCCCA
ATAATATAAAATAATAAGTTTAAAAGTTTAAACATTATGAAAAATTGGCGAATAGTTTGC
TTAGAAGTTATAGCATTTTTTATATATATAAAATAATATGTCTATATTAAGAAATAGGAT
TATGACAAAATTTTAGCAGACTTTATTTAAATCTTAAAATTTTATAAATATAATAGAGGT
AAATACCAACTTGATATGTACAAAAAAACAGTAAGATTCCACGGCTCTTCTTTTAACTAT
ATAGTAGAATATAGTAATGTTATTAAGGGCTTCCTCCTTCCTCAACCTGACGAAGTAAGA
AGATTAAAAAGAGTTATAAGACAATTATAAATCATATTTTAAAAAAGGTACATGTTGCTT
TCGTTCTTGGTTTAGATTAACCCTTAAAAATTGGTAATACTGTTCACTCTTACATAGTTA
TGCAATTCAAAAAAGAACAAAAGGCTAACATCAAAGTAAACATTGATCCTGAAGAAAAGA
AGGAAGATAAATTAAAGGATCTCGATGAAGAATATGATGGATTCTTATATGAAATTGCTG
GTTAATTGTTTAAAACTTTATGTAATAATGTATAAATCATCATGCCTGCTGGTTTCTAAA
GGTAAACAATTAATTTTTTATTTTAGTTGAGTTAAATATAATTTAATAAATAACTAGCTC
TGATAAGTAAAATTGCTTGAAATGTACCCTTAAAACTCACCAAGGTCTTTTATATCCTAT
GAGAAAGAGTTTGATCTTTATATATAAACCTGTAATTCACATATAAATCAGTGATATTTA
AAAGGTCGAATTTAATAGAGTAAAATGAAATTTTTTGTCTAGAAATATTTTATTGAACAA
TTTGCCAAATAATAAAAAAAAATAGGTTGGTAATGCTACTCTGAATAAATTGTTTGATGT
CAAAGTATTTACTAAGACCACAACCCCTCAATTCTTTGGTTTTGAAAGAAAGGAATTAGA
TGTCCTCTTAGAATACTTTAAATCTAAAAATATTAAGATTACATATGATGATACTAATTA
AGGAGCCACTTTTGATGATGAGGATGAGGAATTCACAGACTCTATTTCTGAAGATGAGGA
AGAAGTATAATTTATCTTTTTATTTATTTCTGATAAAAATTTATATTGTAATTAAAGGGT
AAGAGAGCTCAAAGAAAGAGTGCTAAGAGAGCTAATAAAGCAGTAAAAGGATAATCAGGA
TTACCCCTTGACGATGATGACGAAGAAGAAGACGAAGACTTTGATGCTGATGAATTTGAA
AGTGAAGATGATGAGGAAGAGGAAGAAGACGAAGATGAAGATGAAGATTTTGAATAATGA