Identifiers and Description

Gene Model Identifier

TTHERM_01109940

Standard Name

PMS2 (DNA mismatch repair also called pms1)

Aliases

PreTt17964 | 239.m00043 | 3802.m00184

Description

DNA mismatch repair protein, C-terminal domain containing protein; homolog to human PMS2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_01109940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20519.19.997093137033517e-262DNA mismatch repair protein do
main-containing protein (977 a
a)
SGDYNL082W4.000820122464668e-47PMS1 ATP-binding protein requi
red for mismatch repair in mit
osis and meiosis; functions as
a heterodimer with Mlh1p, bin
ds double- and single-stranded
DNA via its N-terminal domain
, similar to E. coli MutL
WormBaseWBGene000040643.0009061039838537e-46locus:pms-2 status:Confirmed
UniProt:G5EFG5 protein_id
:CAA18355.1
DictyBaseDDB_G02839815.998312950603665e-35pms1 on chromosome: 4 position
1418066 to 1421134
OxytrichaContig14864.0.g421.9991517704232713e-32DNA mismatch repair protein, C
-terminal domain
Stentor CoeruleusSteCoe_122582.3195228302435696e-16

General Information

Paragraph NoGene NameParagraph Text
100PMS2TTHERM_01109940 is a close homologs to budding yeast MutL family member, MLH3. TTHERM_01109940p is the first candidate in a BLAST search with Mlh3 as bait, but it is the best hit in a reciprocal BLAST search with Pms1. It is also the best hit with Mlh2 as bait. TTHERM_00127000p is the best hit in a reciprocal BLAST search with Mlh1. Altogether, it is likely that TTHERM_00127000p is the ortholog of Mlh1, whereas TTHERM_01109940p could be any of Pms1, Mlh2 or Mlh3, but an unambiguous assignment is not possible

Associated Literature

  1. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_01109940(coding)
ATGATATGTAGAAAATTAAAACTTAATACTTAAATAATATCTTTAATTAATTTCAGAAAC
AAAAAATTCATCAAAAAGCAAGTTGAATTCTCTTAAAATCAAACAAATAAGGATTACATT
AGTATTAAAAAACAGAGTTTTCATATCTAAATGATAAAGAAGCTTGACTAAAGCTCAATC
TTAAATATATGTGTCAATTAAGTTATCATAGATCTAGCTACATGTGTTAAGGAGTTGGTT
GAAAACAGTCTAGATGCTGGATCAACAAAAATAGAAGTGTATCTCAAAGAATATGGAAAG
GAGGGAGTTGAAGTTGTTGACAACGGGAGTGGTATCAGCTCTTAAAATTTAGAATAAATA
GCTTAGAAAGGTGCAACCAGTAAGCTTCGCTAATTTTAGGATCTTGAAAGTCTAGATACC
TTTGGTTTTAGAGGAGAAGCCCTTAATGCAATAAGTGTTTTAAGTTAACTAACTATCACA
ACTAAGACAGACAGTGATGAAATGGCATACCGTTACTAGTTTAATTAAGATAATACAATT
AAATCAAAGACATTAGTGCCTAGAGAAAGAGGGACTACAATTAGTTTAACAGATTTGTTT
GGTAATATCCCAGTTAGAAAATAAGAATTCAACAAAAATATTATTAGTTAATATAATAAA
TTAGTCAATATGATAACTGAATATGCAATTATTTCTGTTAACTGTTAGATTTGTTTGATC
AATTAATCTTCAAAAAAAGGCAGGGAAATGATTTTGAATTCTGGCTCTCCTATGAAAAAT
ATGCTTTAGAAGACTGCTCAAGTATTCTCAAAAAAAATTTCTGATATGCTTGTTGATTTA
AAATTCGATTTCGGTGAAGAATGTAGTGTAATAGAGGGTTATATATTAAATAGATAGACA
AGTGGTAGTGTTTAAGATTCAAAATCAATATAAAAAAATATGAGTTATCTGTTTGTAAAT
ACTCGCCCAGTGAATCCCTTTAAAAAAATGAACTCTATATTTTCAGATATTTATAAAAAA
TACAATAGTTCAGCTAGATATATCTACATTCTTCATTTAAAAGTGAAGAAAGATGCTATT
GATTTTAATGTTTCGCCAGATAAAAGAGATATTTTTATTAAATATGAAAATGAATTTTAT
ACAGCATTAAGAGATAATTTAACATAGCTATTTGAAAAACTCAATAGTATATAAAAGGTT
TTAATGCCTGTGGTGATTTCTAGCAAAATAAAAGATACATCTATGGATGATTCAGAAGAT
GATAGCTAAGAATCTTCAAATTAACAAAAATAAAAAACTTTATCTACTTAGCAAACTAAA
TAGACAAAATTATTTTAAAAATTAAAATAAGAAATTAATATACAAGAGGAGGATTTGTCA
AATGAAGATAGTGAAGCTAATAATTAAAAAGAATTAGAAATTTTATCATTTAAATCTCCT
TCAAAAGGCAAATAAATTACATAACTGAAAGATACTATCAATAATTAAAGAATTGGTAGC
AGTAACTCGAAAAGAAAATAGGATTTATTTGAGGATGTTAATGACGAAATTGAGGATTTA
AGTAATTTTTCAAGTAATAGCAAAGCTCAAAGCAAACAAAAAAATGATAATAGTGAATAC
TTTAAAAGTAGAAACCAAACTTTTAATTCCGATTATTTTAGTATTGCTTAACAAAGGAAG
AAAGCTTATGAAGAATAATTGTAAAATACAAGAGAAGAATTATAAAATAGTAAAGAAGAA
TATTAAGAAAATTATTAGAAAAAATAGTAAACTTCAAGCAAGGATCATAATAATTAAAAT
AAAACTGATTCTAAATAGCTAATTAATGAAGATGAAGAATAAAATTAAGATTTTTCTTAT
TTCAATGATAAATTAAAATTGTATAAGCAATCAAAATAGTAATCAGAAAATAATTCTAAA
TATTAAGTGAAAGAATATTCTTTTGATATGTTTAAAAAATCGAAATAGGAAAATTCAAGT
AAAGGATAAGATAATTAGAAAATTAATAATGAAGATGAAGAAAATTGTGATGATTAATGT
TGCACACAATCACAGAATTACTCTAATTCATAAAACGAATATAAATCAGAAGATTCATCT
CTTTATAAAATGAAAGAAGAAAAATAAACAAAATAATTAAAATAGTCTTTAAATTAAGAA
GAGCTTGTATAAAAACATTTTTAAATACAAGAAGAAGCTAGAATTTTAAATAAAAAATAA
AATAATGAATTGATGGAAATTGATGAAAAGATAGACTAAGATTAGGGAAGAGCATTTAAA
ATTAAATCAAAAAAAGAAGATGAAATAGAAGAATTGGCTGATGACTTAGAAGAACAATTA
AAAACTTGGGAAAGCGAAGACTTTAAAAAAGACAAGTTTGTTGAATTATAAATTATAGGC
TAGTTTAATAAGGCATTTATCATAGCTTATTGGGTTGAAAAAGATTAAATATTTTTAATT
GATTAGCATGCTTCTGATGAAAAGACTAATTATGAAAGATTGTTAAAAGAAAATAATTTC
TAAGGATAAAAACTAGTTAAACCAATAGAGCTAAGCTTAACAATACAAGAAGCAGACATT
TTAGAAAACAATAGGGAAATATTTAAAAAGAACGGTTTTTAATTCTAAATCAAATATGAT
GAAAGCAATGGAGAACCTAACCTTTACATAAACTAACTTCCCTCAAGCAAGCACATTTAA
TTTAATATAAACGATTTCGATGAAATCTTTTAAAACATAAATAATGAAGAAACAGATATT
GAAACATTTAGGCCTAAAAAAATTTAAAGAATTCTTGCTTCTAAGGCTTGTAGATCTTCA
ATTATGATAGGAACAGCCTTAAATAAGTCATCAATGAAATAAATTTTGTTAAATTTATCT
AAGTTGTAATCACCTTGGAATTGCCCTCATGGACGTCCTACTATGGTTAAAACTCCTCCT
ATGAATCATCTCATACAATAAGTTTAAGTCAAAAAGACATATGATCTTTGA


>TTHERM_01109940(protein)
MICRKLKLNTQIISLINFRNKKFIKKQVEFSQNQTNKDYISIKKQSFHIQMIKKLDQSSI
LNICVNQVIIDLATCVKELVENSLDAGSTKIEVYLKEYGKEGVEVVDNGSGISSQNLEQI
AQKGATSKLRQFQDLESLDTFGFRGEALNAISVLSQLTITTKTDSDEMAYRYQFNQDNTI
KSKTLVPRERGTTISLTDLFGNIPVRKQEFNKNIISQYNKLVNMITEYAIISVNCQICLI
NQSSKKGREMILNSGSPMKNMLQKTAQVFSKKISDMLVDLKFDFGEECSVIEGYILNRQT
SGSVQDSKSIQKNMSYLFVNTRPVNPFKKMNSIFSDIYKKYNSSARYIYILHLKVKKDAI
DFNVSPDKRDIFIKYENEFYTALRDNLTQLFEKLNSIQKVLMPVVISSKIKDTSMDDSED
DSQESSNQQKQKTLSTQQTKQTKLFQKLKQEINIQEEDLSNEDSEANNQKELEILSFKSP
SKGKQITQLKDTINNQRIGSSNSKRKQDLFEDVNDEIEDLSNFSSNSKAQSKQKNDNSEY
FKSRNQTFNSDYFSIAQQRKKAYEEQLQNTREELQNSKEEYQENYQKKQQTSSKDHNNQN
KTDSKQLINEDEEQNQDFSYFNDKLKLYKQSKQQSENNSKYQVKEYSFDMFKKSKQENSS
KGQDNQKINNEDEENCDDQCCTQSQNYSNSQNEYKSEDSSLYKMKEEKQTKQLKQSLNQE
ELVQKHFQIQEEARILNKKQNNELMEIDEKIDQDQGRAFKIKSKKEDEIEELADDLEEQL
KTWESEDFKKDKFVELQIIGQFNKAFIIAYWVEKDQIFLIDQHASDEKTNYERLLKENNF
QGQKLVKPIELSLTIQEADILENNREIFKKNGFQFQIKYDESNGEPNLYINQLPSSKHIQ
FNINDFDEIFQNINNEETDIETFRPKKIQRILASKACRSSIMIGTALNKSSMKQILLNLS
KLQSPWNCPHGRPTMVKTPPMNHLIQQVQVKKTYDL


>TTHERM_01109940(gene)
TTACAAGTAAATTATCAAAAACAAATCATTAGAATGATATGTAGAAAATTAAAACTTAAT
ACTTAAATAATATCTTTAATTAATTTCAGAAACAAAAAATTCATCAAAAAGCAAGTTGAA
TTCTCTTAAAATCAAACAAATAAGGATTACATTAGTATTAAAAAACAGAGTTTTCATATC
TAAATGATAAAGAAGCTTGACTAAAGCTCAATCTTAAATATATGTGTCAATTAAGTTATC
ATAGATCTAGCTACATGTAATATTTCTAAATTTAATTTGAAGAATAATTTAAATTACTTT
TTTTACAGGTGTTAAGGAGTTGGTTGAAAACAGTCTAGATGCTGGATCAACAAAAATAGA
AGTGTATCTCAAAGAATATGGAAAGGAGGGAGTTGAAGTTGTTGACAACGGGAGTGGTAT
CAGCTCTTAAAATTTAGAATAAATAGCTTAGAAAGGTGCAACCAGTAAGCTTCGCTAATT
TTAGGATCTTGAAAGTCTAGATACCTTTGGTTTTAGAGGAGAAGCCCTTAATGCAATAAG
TGTTTTAAGTTAACTAACTATCACAACTAAGACAGACAGTGATGAAATGGCATACCGTTA
CTAGTTTAATTAAGATAATACAATTAAATCAAAGAGTAATTTTCAATTTAAACACATAAA
TTAAATTATCATTCATAAAATATATTTTATTGAAATTATTTTAATTTAACAAGATTTTAT
TATTTAAATTCTTTAAAATTTTTTTTATTATGATGAATAGCATTAGTGCCTAGAGAAAGA
GGGACTACAATTAGTTTAACAGATTTGTTTGGTAATATCCCAGTTAGAAAATAAGAATTC
AACAAAAATATTATTAGTTAATATAATAAATTAGTCAATATGATAACTGAATATGCAATT
ATTTCTGTTAACTGTTAGATTTGTTTGATCAATTAATCTTCAAAAAAAGGCAGGGAAATG
ATTTTGAATTCTGGCTCTCCTATGAAAAATATGCTTTAGAAGACTGCTCAAGTATTCTCA
AAAAAAATTTCTGATATGCTTGTTGATTTAAAATTCGATTTCGGTGAAGAATGTAGTGTA
ATAGAGGGTTATATATTAAATAGATAGACAAGTGGTAGTGTTTAAGATTCAAAATCAATA
TAAAAAAATATGAGTTATCTGTTTGTAAATACTCGCCCAGTGAATCCCTTTAAAAAAATG
AACTCTATATTTTCAGATATTTATAAAAAATACAATAGTTCAGCTAGATATATCTACATT
CTTCATTTAAAAGTGAAGAAAGATGCTATTGATTTTAATGTTTCGCCAGATAAAAGAGAT
ATTTTTATTAAATATGAAAATGAATTTTATACAGCATTAAGAGATAATTTAACATAGCTA
TTTGAAAAACTCAATAGTATATAAAAGGTTTTAATGCCTGTGGTGATTTCTAGCAAAATA
AAAGATACATCTATGGATGATTCAGAAGATGATAGCTAAGAATCTTCAAATTAACAAAAA
TAAAAAACTTTATCTACTTAGCAAACTAAATAGACAAAATTATTTTAAAAATTAAAATAA
GAAATTAATATACAAGAGGAGGATTTGTCAAATGAAGATAGTGAAGCTAATAATTAAAAA
GAATTAGAAATTTTATCATTTAAATCTCCTTCAAAAGGCAAATAAATTACATAACTGAAA
GATACTATCAATAATTAAAGAATTGGTAGCAGTAACTCGAAAAGAAAATAGGATTTATTT
GAGGATGTTAATGACGAAATTGAGGATTTAAGTAATTTTTCAAGTAATAGCAAAGCTCAA
AGCAAACAAAAAAATGATAATAGTGAATACTTTAAAAGTAGAAACCAAACTTTTAATTCC
GATTATTTTAGTATTGCTTAACAAAGGAAGAAAGCTTATGAAGAATAATTGTAAAATACA
AGAGAAGAATTATAAAATAGTAAAGAAGAATATTAAGAAAATTATTAGAAAAAATAGTAA
ACTTCAAGCAAGGATCATAATAATTAAAATAAAACTGATTCTAAATAGCTAATTAATGAA
GATGAAGAATAAAATTAAGATTTTTCTTATTTCAATGATAAATTAAAATTGTATAAGCAA
TCAAAATAGTAATCAGAAAATAATTCTAAATATTAAGTGAAAGAATATTCTTTTGATATG
TTTAAAAAATCGAAATAGGAAAATTCAAGTAAAGGATAAGATAATTAGAAAATTAATAAT
GAAGATGAAGAAAATTGTGATGATTAATGTTGCACACAATCACAGAATTACTCTAATTCA
TAAAACGAATATAAATCAGAAGATTCATCTCTTTATAAAATGAAAGAAGAAAAATAAACA
AAATAATTAAAATAGTCTTTAAATTAAGAAGAGCTTGTATAAAAACATTTTTAAATACAA
GAAGAAGCTAGAATTTTAAATAAAAAATAAAATAATGAATTGATGGAAATTGATGAAAAG
ATAGACTAAGATTAGGGAAGAGCATTTAAAATTAAATCAAAAAAAGAAGATGAAATAGAA
GAATTGGCTGATGACTTAGAAGAACAATTAAAAACTTGGGAAAGCGAAGACTTTAAAAAA
GACAAGTTTGTTGAATTATAAATTATAGGCTAGTTTAATAAGGCATTTATCATAGCTTAT
TGGGTTGAAAAAGATTAAATATTTTTAATTGATTAGCATGCTTCTGATGAAAAGACTAAT
TATGAAAGATTGTTAAAAGAAAATAATTTCTAAGGATAAAAACTAGTTAAACCAATAGAG
CTAAGCTTAACAATACAAGAAGCAGACATTTTAGAAAACAATAGGGAAATATTTAAAAAG
AACGGTTTTTAATTCTAAATCAAATATGATGAAAGCAATGGAGAACCTAACCTTTACATA
AACTAACTTCCCTCAAGCAAGCACATTTAATTTAATATAAACGATTTCGATGAAATCTTT
TAAAACATAAATAATGAAGAAACAGATATTGAAACATTTAGGCCTAAAAAAATTTAAAGA
ATTCTTGCTTCTAAGGCTTGTAGATCTTCAATTATGATAGGAACAGCCTTAAATAAGTCA
TCAATGAAATAAATTTTGTTAAATTTATCTAAGTTGTAATCACCTTGGAATTGCCCTCAT
GGACGTCCTACTATGGTTAAAACTCCTCCTATGAATCATCTCATACAATAAGTTTAAGTC
AAAAAGACATATGATCTTTGA