Identifiers and Description

Gene Model Identifier

TTHERM_00470470

Standard Name

PMR1 (potential mRNA regulator 1)

Aliases

PreTt22461 | 56.m00165 | 3686.m00008

Description

Hypothetical Protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF07133 ) Merozoite surface protein (SPAM)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00470470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11395.19.997093137033517e-262hypothetical protein (1195 aa)
OxytrichaContig22030.0.g971.9994498063102785e-22Leucine Rich repeats (2 copies
)

General Information

Paragraph NoGene NameParagraph Text
31PMR1Tetrahymena thermophilia PMR1 (potential mRNA regulator) is homologous to proteins from the LRR_RI domain. The domain suggests that the protein is similar to Leucine rich repeat, ribonucleus inhibiter (Evalue = 7.51 × 〖10〗^(-6)). The leucine rich protein may form tight complexes with a certain ribonuclease, or may be involved in other protein-protein interactions. It is possible that the PMR plays a role in regulating the lifetime of RNA like the ribonuclease inhibitor. Paragraph provided by undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00470470(coding)
ATGTCAGTTCGACCCTAATCTGCTTAAGTAGCATCTGCTAAAAATCAAGTTTCAGCAAAT
TCAAATTTAAATCATTAGAAAGGTAACTCAATCGCTAACGGTCAAGTAAATGCAGGAGGA
GCAAGTTTAAAAAATGGAGCATCTACTTCCTCTCGTTAGAGATAGTAAGCTTAAAGTCTC
GCCATTAAGCGCAAAAAGAATTAAACTCCTTTTTCATTTTATAAGGATGTTTGTTAGAAG
CTTAACTGCAACATGAACAACGCAATCACACATGGCTTAAAAGGGGATGAATTAATTATT
AACGTTGATAACTTAACTTCACCTGATGTAGATCCAATGAGAGTTTTGCTAAGAGAATGC
GAGTTTTCTATCATTACTCTGACTGGAAATAAAGAATTTAACGAAGAAAAGTTTTATTAA
GAACATGAATAAATCATATTTAATTACCGCAATTAATCAACTATTAGCAATACTAATAGC
ATTTCAAAAATAAATTTACCTCACTAAAATAATTTTGGTATGTCTTCTAATGGATTTTAA
ACAGTAGATGAAAGAGGAAGAACTCTTAATCAAGATTTAGGATATAATGATGGGCATTAA
GGTGGTTTAACACCATTAGGAAATCACAACAGTTAGAAGTAAAGAATAGGTGATGCATCA
AACAAAAGCTAAAACAACAAGGATAATCTAGGAGGTTTTAAAAAGTTATCGAATGCAACT
GCAGAAGGGAGCTAAAATATTAAAGATGGAGCAAACAAATCTAAAAAGCAGAAGAAGAAT
TTTAGCAGTTAAACTTAGAGTTTTAATTAATTGATGCATTCAGTAGGGCTCAATATTGGA
AGAGCTTCAACTTCGGATGTTCAGCTTACAGTAGTGAAAATAATAAATTTAAATTTGAAA
GCTGAAAGTTTAGCAGCAATATGCTAAGGACTATAGAAGTCACAAACAGTGAAAGAGCTC
TACATTTAGAACTGTAATTTAAATTCTGAAACAATAGAAAAAGGAATGCTTCCATATATT
GGTGAAACTAGATCACTAAATTTGCTTGATCTCTCTTTTAATAAACTAGATGGTTAATCA
GGAGGATTAATCGGTAAGCTTCTTTCTTCACACTCTAAAAATAGAGATGAGCACATATGG
TTATGTGGCCTTAGAGGAGAAGTTCCTGAAAATAATGTAAACCTAGAAGGTATTTGTGAA
GTCAATTTAATGGGAAATTTATTAACAGATAGCAGCATCAAAGATTTATGCTACTTTTTA
TAATAAGATGGTTGGACACGTAATATAAATTTACGTTTTAATCGCATCGGAGCTGATGGT
CTTGTTGAATTAAACAAGATGCTAGATAATAATGAAAACCTAATTAGCTTAGACATACGC
AATAATCCAGGTATGACTCCTAATGCAGATGACTATTAGAAATATGGCTAGTCAATAAAA
TTTATTTCAAAGAGTATTTTTAATAGACTCCTCAACAATATTAAGGTGTTTAAATAAAAA
CACGATGATATGACAAGAAAGCAATAAGAATAAATTATTACAAACATTTTATATGAAAAT
AATAATTAGCTTCCTCCCAACATTTTCCCTTAAATTTAACAAGACGAAGCTGCTATGATG
ATGATGGCCTCTTAAAATTAATAGCAATAGTAACAGTTACAACATCCAAACCTTATACCC
CAGCAATAAAATTATTTAGGTTAGGTACCATAATAGTAGTAATAGTAGTAATTACAATTA
CAATAAGAGTAATTATATATGCAATATTAATAATAAAATTAATAACAATTAATGTTGTAG
TAGTAATAGTAGCAATAACAGGATATTAACTACCAGGCAAATTTATAAGGATAAAATTTG
TAATAGATTCAGTAAGAAATATAGGCTTAGAATGCTTAAATGTATGCTCAATAAGCAGCA
AATATACCTCAAGAGTAATAGTATAAGCACTTAGAAAATTAAGAAGATGAGTATCAAGAT
GAGGATTAGTAAGAGAAAGATTAGGAAGATGGAAATGAGGAGCTTTAATAATAAGAAGAA
TAAGGTTAAGAAGAATTACATGCTGAAGAAGGAGATGAAGAGTTAACTGAGGAGCAGCTA
TTACTAAAAGAAAAACAAAATTTTGTTTTGAGTGAGGAATTTATTGAAATTCAATAATAA
AATTTCGCAAACGAATATGGAGATAATTAAGACTTTTTAAATTTAACTCCTGAAGAGCAA
GAAATAGTTTTCTAACAATATCTTACTCATCACTAACAGTAATATTTGCTTGAACTAGAA
AATGAAGAATAAATGGAAGGAGTTTAAGAGGTTCAAGAAGAATAATATGAAGAAGATGAT
GAAGAGGACGAAAATTAACCACACGATAATCATTATAATGAATAATAGATTTATTACTAA
TAAAATGAAGCAAATAATGAAATCCATGAGGTGGATGCATTAAAAAAAAATAGTAAAGTC
TAAAATTAAGATTTTGATTAGAATAAAGATTAAGTAGAATTTCAAGAGAACGAACATGAT
GAAGAAGTTACAGAAAATAATTAAAATATTGAAGATTTTCCTTAGGAAATTGAAGAAGAA
GAGTATGATGAAGAGAAAATAAAGCAAGTTATGGATTAAATCTATTAAAATTAAAATTTA
GAGCAAATCGTTGATAAAAATTGTAAATGTTGCCTGCAATTACAAGATAAAATACTTTAA
TCTGAATACGAAAAACTGATTATACTTATTAAGTGGAATAATTGCAAAGTTCGCTTGCAG
TAAATCGAAAAACAAAATGACTCTTAAAAAGCAAGCTTAAAGCAATAAATTTAATAACTA
CAGTTAACAGCTTCATAGCAGAATTAATAATTGTAGCAATAGCAAATAGCTAATAGCTGG
TCTGCAATATAACCTAACACTATGGATTAAGAAAATAATAATTTAATAATGCATCCTGAA
AGCTTTTTACTTGGAGGTAAGCCCTAACAGTAGCTAGCCATGAATGCAAATCCTTAAGGA
AACGATTAAAATGAGGGAGAAGACAACATGTTAAACAGGATTGAAGGTCTGATGACTGAA
CTAACACGCCTTATGGATAATTTAGAAATAATGTAAAATAATGTGACTAACAATATAACT
TGCTAATTATCAAATACCACTAATACTAATAATCAAACTTACCATCTCCTTAACTCAAAT
CCTAATATTAACTTTAACAATACTTTCACAAATATTTTAGGAGGATCCCATAATAATTCA
AACATTTTACCTAGAAATGCTAATTCCAACCTTTTGAACAATTTAAATCAGTAAACAATT
ATTTAATAATAACAAACCTCCACCTTTGTTCCATCACAATCTTCAAATAATAATACTTAA
ATATAATAAGTATCTTCTACTTAAAGTGGATAAAAAAAATAGAAAAAGAATCCTTAAAGG
TAAATTGTATAGTAGTAATACTACTAATAACAACAATAATAACCTTAATAACTAATTCAA
GCATAGCAGTAGTCACAACAATAAAAATTTAGTGGACACAATAACTCTAGATGA


>TTHERM_00470470(protein)
MSVRPQSAQVASAKNQVSANSNLNHQKGNSIANGQVNAGGASLKNGASTSSRQRQQAQSL
AIKRKKNQTPFSFYKDVCQKLNCNMNNAITHGLKGDELIINVDNLTSPDVDPMRVLLREC
EFSIITLTGNKEFNEEKFYQEHEQIIFNYRNQSTISNTNSISKINLPHQNNFGMSSNGFQ
TVDERGRTLNQDLGYNDGHQGGLTPLGNHNSQKQRIGDASNKSQNNKDNLGGFKKLSNAT
AEGSQNIKDGANKSKKQKKNFSSQTQSFNQLMHSVGLNIGRASTSDVQLTVVKIINLNLK
AESLAAICQGLQKSQTVKELYIQNCNLNSETIEKGMLPYIGETRSLNLLDLSFNKLDGQS
GGLIGKLLSSHSKNRDEHIWLCGLRGEVPENNVNLEGICEVNLMGNLLTDSSIKDLCYFL
QQDGWTRNINLRFNRIGADGLVELNKMLDNNENLISLDIRNNPGMTPNADDYQKYGQSIK
FISKSIFNRLLNNIKVFKQKHDDMTRKQQEQIITNILYENNNQLPPNIFPQIQQDEAAMM
MMASQNQQQQQQLQHPNLIPQQQNYLGQVPQQQQQQQLQLQQEQLYMQYQQQNQQQLMLQ
QQQQQQQDINYQANLQGQNLQQIQQEIQAQNAQMYAQQAANIPQEQQYKHLENQEDEYQD
EDQQEKDQEDGNEELQQQEEQGQEELHAEEGDEELTEEQLLLKEKQNFVLSEEFIEIQQQ
NFANEYGDNQDFLNLTPEEQEIVFQQYLTHHQQQYLLELENEEQMEGVQEVQEEQYEEDD
EEDENQPHDNHYNEQQIYYQQNEANNEIHEVDALKKNSKVQNQDFDQNKDQVEFQENEHD
EEVTENNQNIEDFPQEIEEEEYDEEKIKQVMDQIYQNQNLEQIVDKNCKCCLQLQDKILQ
SEYEKLIILIKWNNCKVRLQQIEKQNDSQKASLKQQIQQLQLTASQQNQQLQQQQIANSW
SAIQPNTMDQENNNLIMHPESFLLGGKPQQQLAMNANPQGNDQNEGEDNMLNRIEGLMTE
LTRLMDNLEIMQNNVTNNITCQLSNTTNTNNQTYHLLNSNPNINFNNTFTNILGGSHNNS
NILPRNANSNLLNNLNQQTIIQQQQTSTFVPSQSSNNNTQIQQVSSTQSGQKKQKKNPQR
QIVQQQYYQQQQQQPQQLIQAQQQSQQQKFSGHNNSR


>TTHERM_00470470(gene)
ATGTCAGTTCGACCCTAATCTGCTTAAGTAGCATCTGCTAAAAATCAAGTTTCAGCAAAT
TCAAATTTAAATCATTAGAAAGGTAACTCAATCGCTAACGGTCAAGTAAATGCAGGAGGA
GCAAGTTTAAAAAATGGAGCATCTACTTCCTCTCGTTAGAGATAGTAAGCTTAAAGTCTC
GCCATTAAGCGCAAAAAGAATTAAACTCCTTTTTCATTTTATAAGGATGTTTGTTAGAAG
CTTAACTGCAACATGAACAACGCAATCACACATGGCTTAAAAGGGGATGAATTAATTATT
AACGTTGATAACTTAACTTCACCTGATGTAGATCCAATGAGAGTTTTGCTAAGAGAATGC
GAGTTTTCTATCATTACTCTGACTGGAAATAAAGAATTTAACGAAGAAAAGTTTTATTAA
GAACATGAATAAATCATATTTAATTACCGCAATTAATCAACTATTAGCAATACTAATAGC
ATTTCAAAAATAAATTTACCTCACTAAAATAATTTTGGTATGTCTTCTAATGGATTTTAA
ACAGTAGATGAAAGAGGAAGAACTCTTAATCAAGATTTAGGATATAATGATGGGCATTAA
GGTGGTTTAACACCATTAGGAAATCACAACAGTTAGAAGTAAAGAATAGGTGATGCATCA
AACAAAAGCTAAAACAACAAGGATAATCTAGGAGGTTTTAAAAAGTTATCGAATGCAACT
GCAGAAGGGAGCTAAAATATTAAAGATGGAGCAAACAAATCTAAAAAGCAGAAGAAGAAT
TTTAGCAGTTAAACTTAGAGTTTTAATTAATTGATGCATTCAGTAGGGCTCAATATTGGA
AGAGCTTCAACTTCGGATGTTCAGCTTACAGTAGTGAAAATAATAAATTTAAATTTGAAA
GCTGAAAGTTTAGCAGCAATATGCTAAGGACTATAGAAGTCACAAACAGTGAAAGAGCTC
TACATTTAGAACTGTAATTTAAATTCTGAAACAATAGAAAAAGGAATGCTTCCATATATT
GGTGAAACTAGATCACTAAATTTGCTTGATCTCTCTTTTAATAAACTAGATGGTTAATCA
GGAGGATTAATCGGTAAGCTTCTTTCTTCACACTCTAAAAATAGAGATGAGCACATATGG
TTATGTGGCCTTAGAGGAGAAGTTCCTGAAAATAATGTAAACCTAGAAGGTATTTGTGAA
GTCAATTTAATGGGAAATTTATTAACAGATAGCAGCATCAAAGATTTATGCTACTTTTTA
TAATAAGATGGTTGGACACGTAATATAAATTTACGTTTTAATCGCATCGGAGCTGATGGT
CTTGTTGAATTAAACAAGATGCTAGATAATAATGAAAACCTAATTAGCTTAGACATACGC
AATAATCCAGGTATGACTCCTAATGCAGATGACTATTAGAAATATGGCTAGTCAATAAAA
TTTATTTCAAAGAGTATTTTTAATAGACTCCTCAACAATATTAAGGTGTTTAAATAAAAA
CACGATGATATGACAAGAAAGCAATAAGAATAAATTATTACAAACATTTTATATGAAAAT
AATAATTAGCTTCCTCCCAACATTTTCCCTTAAATTTAACAAGACGAAGCTGCTATGATG
ATGATGGCCTCTTAAAATTAATAGCAATAGTAACAGTTACAACATCCAAACCTTATACCC
CAGCAATAAAATTATTTAGGTTAGGTACCATAATAGTAGTAATAGTAGTAATTACAATTA
CAATAAGAGTAATTATATATGCAATATTAATAATAAAATTAATAACAATTAATGTTGTAG
TAGTAATAGTAGCAATAACAGGATATTAACTACCAGGCAAATTGTAAATTTTTTTAAAAA
TTAAACAAAAAATATGTTAATAAATTTTTTATTTCAAAATTTAAAAGTATAAGGATAAAA
TTTGTAATAGATTCAGTAAGAAATATAGGCTTAGAATGCTTAAATGTATGCTCAATAAGC
AGCAAATATACCTCAAGAGTAATAGTATAAGCACTTAGAAAATTAAGAAGATGAGTATCA
AGATGAGGATTAGTAAGAGAAAGATTAGGAAGATGGAAATGAGGAGCTTTAATAATAAGA
AGAATAAGGTTAAGAAGAATTACATGCTGAAGAAGGAGATGAAGAGTTAACTGAGGAGCA
GCTATTACTAAAAGAAAAACAAAATTTTGTTTTGAGTGAGGAATTTATTGAAATTCAATA
ATAAAATTTCGCAAACGAATATGGAGATAATTAAGACTTTTTAAATTTAACTCCTGAAGA
GCAAGAAATAGTTTTCTAACAATATCTTACTCATCACTAACAGTAATATTTGCTTGAACT
AGAAAATGAAGTAATAACATTGAAATTCAATTATCTTTTTTGTTTATTTATTTTTTGTTA
AAAATTCTTAAATTATAAAGGAATAAATGGAAGGAGTTTAAGAGGTTCAAGAAGAATAAT
ATGAAGAAGATGATGAAGAGGACGAAAATTAACCACACGATAATCATTATAATGAATAAT
AGATTTATTACTAATAAAATGAAGCAAATAATGAAATCCATGAGGTGGATGCATTAAAAA
AAAATAGTAAAGTCTAAAATTAAGATTTTGATTAGAATAAAGATTAAGTAGAATTTCAAG
AGAACGAACATGATGAAGAAGTTACAGAAAATAATTAAAATATTGAAGATTTTCCTTAGG
AAATTGAAGAAGAAGAGTATGATGAAGAGAAAATAAAGCAAGTTATGGATTAAATCTATT
AAAATTAAAATTTAGAGCAAATCGTTGATAAAAATTGTAAATGTTGCCTGCAATTACAAG
ATAAAATACTTTAATCTGAATACGAAAAACTGATTATACTTATTAAGTGGAATAATTGCA
AAGTTCGCTTGCAGTAAATCGAAAAACAAAATGACTCTTAAAAAGCAAGCTTAAAGCAAT
AAATTTAATAACTACAGTTAACAGCTTCATAGCAGAATTAATAATTGTAGCAATAGCAAA
TAGCTAATAGCTGGTCTGCAATATAACCTAACACTATGGATTAAGAAAATAATAATTTAA
TAATGCATCCTGAAAGCTTTTTACTTGGAGGTAAGCCCTAACAGTAGCTAGCCATGAATG
CAAATCCTTAAGGAAACGATTAAAATGAGGGAGAAGACAACATGTTAAACAGGATTGAAG
GTCTGATGACTGAACTAACACGCCTTATGGATAATTTAGAAATAATGTAAAATAATGTGA
CTAACAATATAACTTGCTAATTATCAAATACCACTAATACTAATAATCAAACTTACCATC
TCCTTAACTCAAATCCTAATATTAACTTTAACAATACTTTCACAAATATTTTAGGAGGAT
CCCATAATAATTCAAACATTTTACCTAGAAATGCTAATTCCAACCTTTTGAACAATTTAA
ATCAGTAAACAATTATTTAATAATAACAAACCTCCACCTTTGTTCCATCACAATCTTCAA
ATAATAATACTTAAATATAATAAGTATCTTCTACTTAAAGTGGATAAAAAAAATAGAAAA
AGAATCCTTAAAGGTAAATTGTATAGTAGTAATACTACTAATAACAACAATAATAACCTT
AATAACTAATTCAAGCATAGCAGTAGTCACAACAATAAAAATTTAGTGGACACAATAACT
CTAGATGA