Identifiers and Description

Gene Model Identifier

TTHERM_00992960

Standard Name

PLK1 (Polo-Like Kinase)

Aliases

PreTt18357 | 186.m00073

Description

Polo-like kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00992960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04359.19.997093137033517e-262hypothetical protein (1099 aa)
OxytrichaContig14897.0.1.g599.003513400998346e-160Protein kinase domain
DictyBaseDDB_G02745032.0000857274312427e-108plk on chromosome: 2 position
4379150 to 4382891
SGDYMR001C9.000169967702421e-91CDC5 Polo-like kinase with mul
tiple functions in mitosis and
cytokinesis through substrate
phosphorylation, also functio
ns in adaptation to DNA damage
during meiosis; has similarit
y to Xenopus Plx1 and S. pombe
Plo1p; possible Cdc28p substr
ate
WormBaseWBGene000040429.996584278131743e-91locus:plk-1 Serine/threonine
-protein kinase plk-1 status
:Confirmed UniProt:P34331
protein_id:CCD64438.1
Stentor CoeruleusSteCoe_360415.96629836401057e-72

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00992960(coding)
ATGGCAAGTAATCGTAGAAGTTCAGCTGAGCCAGGCCACACTGAGAGCATGGTAATAGTA
GAAGAAGTTATTAAGGATTAAGGAGTAATCAGAAGATACTCAAAGGGTCGCTTTTTGGGA
AAAGGTGGTTTTGCAAAGTGCTATGAATTTACAAATTTAGAAAGAAAATAAGTATTAGCT
GCTAAGGTTATTCCTAAGAGCTCTTTAACTAAGAGCCGTGCTCGCTAAAAATTAATGAGC
GAAATAAGAATCCACAAGTCTTTAAACCATAGAAATATAGTGAAATTTTAACATTTTTTT
GAGGACTAAGAAAATGTCTACATATTGTTAGAGATGTGTACAAATCAGACAATGAATGAA
CTTATCAGGAGAAGAAAGAGATTGACTGAATTAGAAGTTTAATGCTATTTATTGCAGATT
CTTTATTCAATCAAATACTTACATGATAACAGAGTGATACATCGTGATCTCAAATTAGGA
AATTTATTTTTATCTGATAAGATGGAAATTAAACTAGGAGATTTTGGATTGGCTACAAAA
CTAGAATATGATGGAGAAAGAAAACGCACTATTTGCGGTACTCCTAATTATATAGCTCCT
GAAATTTTAGAAGCGAAAGAAACAGGTCACTCATATGAAGTCGACGTTTGGTCTTTCGGT
GTTATTGCATATACTTTACTAATAGGTAAACCACCTTTTGAAACAAACGACGTAAAATCT
ACCTACAAGAAAATCAGAACAAATGAATACTCCTTCCCAGAATAAATTCAAATTTCATCT
GCTGCCAAAAATATGATAAAAAAGATTCTCACGACTGATCCTTCGAAGAGACCCACTATT
AATGAATTATTTAATGACGATTTTTTCAAAACAGGTGGATCAATTCCTAAACTGCTACCT
GTAAGCACTCTTGCTTGCCCTCCAAGTGCCTCATATACTCGCTAATTCTTACCTTCAACA
CAAATTTCTTTATCTACCAATCAAAAATCTACAAATTATTAAGTAGAGAATAAGAATAGC
TCACCTAAAAAATTTGACAACACAACTCCTATTAATGGAAATGGTTTTACACGTTTTGCA
ACCCAAACTTCCTATAATCCTTAAAATGTAAAATCTTAATAGTAGATGGGTTTAAAAGAG
AGAAAAGACTATATTAATACTTACCGTACAGGTGGAGCTTAAACAAGTAGCAGTTCAGGT
TTATGTAATAGTTAGTATGGCTAAAAGAATTTTGATACTAATAACGTTAATAACTAAAAA
ATAGACAACTTTTTGTAAACAAATAAGAACACCTATGGGTTAAATGGAAGTGTAGCAAAA
GAATAATGCTTCCAAAAAAGTTCTAGTTTAAATCCATAAAGTGAAGGTACCACTATCACA
AATAATTTAAATTTGGGAATACTCAATTTTGCTAAAAGTCAAAGTACAAACACTTAATTA
GTCGAAAACAGTAACCTCAACAGTTAGAAAACAGATAATTATATTCAAAAAATGGATGAA
TGCAGCCAAAAAGCCTAGCCATAGGTACAAAATTCTAATTAACACAAATCAGAAGATTAT
AGTAAGAATAGTTGCTTAACAAATTAAAAATATACTTCTCAAGCTAGTCATCCTCAAAGT
TAAGCAGCTTTAAATTCTGTTTAAAGCCAAGCTAATATTAAGAATATTAATAATAGTACA
AGCATAGCTAATTTTGCTTATAATTAAAGTTCTGCCGCAATTAACTCAAATACTAATTTG
ATTTCTACTAACTTAAATAATCTCAGCGGAGGAGCTAGCTCTATCAGTAATCAGAATTAC
TTATCTCAAAATAAAAATTATCCTTCATAATAATCTACAAATGCAGTATTTAACAGAAAC
TCAATTGAAAAATATTCTAGCTCAAACAATATTAGATCTGGAAATTCTAACTATACTCGT
GCTAAATCTGAAAAAATGCATACATAACCTACTTCAAGTCTCCTTTAAGCATATGGTTTC
ACAAAAGTTGAATAAGCTCCTTCTAGTGGAACTACTGCCCTTAACTTTAATAATAGTGGC
TCTTACTTCTAAGCTCCAGTAAGCTCTAATGAAGTTCAAATCTAAGGTCCTGATATTTGG
GTTTCAAAATGGGTAGACTACTCTTCAAAATACGGTTTAGGCTATCTATTAAATAATGGC
TAAGCAGGTGTTTTCTTTAACGACTCAACTAAGATTATTCTTAATCCAAAAACAGAATAA
TTTGATTACATCGAGAGAAATTCTTCTTCCAAATAAGACTTTGGGGCAGAATATACACTT
AAGGATTATCCTGAATCTCTTTAAAAGAAATTGACTTTGTTATAGCATTTCCGTAGTTTT
TTAGAAGGAGAAGACAAGAAAGCAGATTCTATAAAAATGCCATAGAATGAGGCTAGTGGT
GAACCTAAATCTTCTAAAATATATGTTAAGAAATGGCTACGTACAAAAAATGCTATCCTT
TTCCGTTTGAGCAATAAAGTAGTTTAAGTTATTTTTTAGGACAGCTCTGAAATTATCTTG
AGTAGTGAGCTTCGTGCTGTAACTTATGTTAATAGGAAGAAATAAAGAGAAACCTTTCCT
CTTAGCACTGCTATGGAGTCATAAAACAAAGAAATGTCAAAGCGTCTTACATACACCAAA
GATATATTAACTCATATGCTTAGTGGTAATGTGTAAAGCAAAGGTGAACAATAGAATAAT
GAAAATATTTCTGTTTAAGATCCTACTTCTACTATTACTAATCCAATTGGATTAATAAAT
TAAAATTAAGATGGTAAAGAGAAAAACCATTCTAAGAACTAATCAATTAATCCAAATTCT
TGCTCTAGTGCAAGTCTTTACCCAACTGCAACTACAACTTAATATGCAAATAATAATAGT
TCTTCTTAAATTTAACCTTCTTAAAAGCCTTCGACTAGAGAGAATCTCCACTACTCTAAA
AATGTGCCACTCTCTTCTGTAACTAACTCTATATATATGCAAAATCAATAGTCTAATCCT
ATTTATAATAATTACACCTAGAATGAAAATGTTAATGTATTGCTACTTAACAAACAGCAG
AGCTTGTAAAATTAAAAGCCTTCAATTAATGGTTATGAGTTAAATGGATTCGCAAGTAGC
AATAGTGCAAACAAGAAGGAATCTTTAGCTACTAATTCTAATATTATAAATAGCACTGAA
GGTAAATGCCTTGGACAGCCTTCAAATATTTAAAACCTATTAAAGAGTAACTCTACTATT
GGTAGAATGAATTCTATGAATCCTACTGCTACCAGCTCTCTTTCTAATCTAAATAATTTT
AATAACTATGTAATGAGTTCACGTAAAACTGAAAATTGA


>TTHERM_00992960(protein)
MASNRRSSAEPGHTESMVIVEEVIKDQGVIRRYSKGRFLGKGGFAKCYEFTNLERKQVLA
AKVIPKSSLTKSRARQKLMSEIRIHKSLNHRNIVKFQHFFEDQENVYILLEMCTNQTMNE
LIRRRKRLTELEVQCYLLQILYSIKYLHDNRVIHRDLKLGNLFLSDKMEIKLGDFGLATK
LEYDGERKRTICGTPNYIAPEILEAKETGHSYEVDVWSFGVIAYTLLIGKPPFETNDVKS
TYKKIRTNEYSFPEQIQISSAAKNMIKKILTTDPSKRPTINELFNDDFFKTGGSIPKLLP
VSTLACPPSASYTRQFLPSTQISLSTNQKSTNYQVENKNSSPKKFDNTTPINGNGFTRFA
TQTSYNPQNVKSQQQMGLKERKDYINTYRTGGAQTSSSSGLCNSQYGQKNFDTNNVNNQK
IDNFLQTNKNTYGLNGSVAKEQCFQKSSSLNPQSEGTTITNNLNLGILNFAKSQSTNTQL
VENSNLNSQKTDNYIQKMDECSQKAQPQVQNSNQHKSEDYSKNSCLTNQKYTSQASHPQS
QAALNSVQSQANIKNINNSTSIANFAYNQSSAAINSNTNLISTNLNNLSGGASSISNQNY
LSQNKNYPSQQSTNAVFNRNSIEKYSSSNNIRSGNSNYTRAKSEKMHTQPTSSLLQAYGF
TKVEQAPSSGTTALNFNNSGSYFQAPVSSNEVQIQGPDIWVSKWVDYSSKYGLGYLLNNG
QAGVFFNDSTKIILNPKTEQFDYIERNSSSKQDFGAEYTLKDYPESLQKKLTLLQHFRSF
LEGEDKKADSIKMPQNEASGEPKSSKIYVKKWLRTKNAILFRLSNKVVQVIFQDSSEIIL
SSELRAVTYVNRKKQRETFPLSTAMESQNKEMSKRLTYTKDILTHMLSGNVQSKGEQQNN
ENISVQDPTSTITNPIGLINQNQDGKEKNHSKNQSINPNSCSSASLYPTATTTQYANNNS
SSQIQPSQKPSTRENLHYSKNVPLSSVTNSIYMQNQQSNPIYNNYTQNENVNVLLLNKQQ
SLQNQKPSINGYELNGFASSNSANKKESLATNSNIINSTEGKCLGQPSNIQNLLKSNSTI
GRMNSMNPTATSSLSNLNNFNNYVMSSRKTEN


>TTHERM_00992960(gene)
ATGGCAAGTAATCGTAGAAGTTCAGCTGAGCCAGGTAAGCTACTAGCATTTATTATATAT
TTTTTCATTCAAAACTAATGCATATTTAATTTATATTTGCAAGGATTATTAGTTTACTTG
TTATTTAAAATTAAAATATTTTGAAAATTAGGCCACACTGAGAGCATGGTAATAGTAGAA
GAAGTTATTAAGGATTAAGGAGTAATCAGAAGATACTCAAAGGGTCGCTTTTTGGGAAAA
GTAAAGCATATATACTATCTATTAATTCAATATGATTCAACTTTAATCTAAATTACAGCT
TATAATTCCTTTGTTTAAATGTTTGTAAATTTTTACTATTAATAAATTCATAAAATAAAA
AGGGTGGTTTTGCAAAGTGCTATGAATTTACAAATTTAGAAAGAAAATAAGTATTAGCTG
CTAAGGTTATTCCTAAGAGCTCTTTAACTAAGAGCCGTGCTCGCTAAAAAGTGATAAATT
ATTTTATTTTATTGATAATTTACAAATCAGAATGAAATTTAGTAGGGATTGCTAGTCTAT
TTATGATCTATTAATACTTACCAATTAATTAAAATTACGTTGTTATTTCTTATTGAATTT
TGAAATTAAAAATCAAATAAACAGACAGAAACACAGAAAAAAACATTCTCATAAATAATA
AAGTCAATCAATCAATCAATCAAAATTAAATTGAATAGATCACTTGATTTATTTGATAGC
ATTAAATCATAGTTTATTCAAGCTAGCTTAGACTAAATTTTATATTCGCTTTAAAATAAT
ATTCCCAAACATTAAAAATTTCAATTCTTTTAAAATGATTTTGATTTTATGATATCTTTT
AATATTATTTTTTAATTTATAAAGTTAATGAGCGAAATAAGAATCCACAAGTCTTTAAAC
CATAGAAATATAGTGAAATTTTAACATTTTTTTGAGGACTAAGAAAATGTCTACATATTG
TTAGAGATGTGTACAAATCAGGTAAATGTTTACATTTCTCAATTTCATAATGATTATATG
AAAAAAATTATTTTTATTATTTCTTTTTACACAGGAAATATTTTTATTACTATTATTTTG
TATTTCAATTTCTTCAAATTTTTTAATATTAATTTTTGAATTTTACTACATCAATAAAAT
AATCAGTTAACAAACATAATTAAGTCTCAAGTTATTAAATTACACAATAGTGATAAAAGC
GCAAGAAAAAAAAAAAGAATTTATCTGATTTTCATTAAAAAATAAGAAAAAACTTGCTAA
ACACAGAAATAGTTTTTATTTTAAATTAGTCGAATTGTTTATAAAAAATAAACTAAGATA
GTTTATAAACGAATAATCAACTTATATATAAAAGAATATTTGAAGGATATTTATGAATCA
TTTAATCTATAAATTATAAAAAATGATTGAAATCAAACACAGTTGATTAATTAATTAACT
AATTATAATAATATGTATTAAAAGACAATGAATGAACTTATCAGGAGAAGAAAGAGATTG
ACTGAATTAGAAGTTTAATGCTATTTATTGCAGATTCTTTATTCAATCAAATACTTACAT
GATAACAGAGTGATACATCGTGATCTCAAATTAGGAAATTTATTTTTATCTGATAAGATG
GAAATTAAACTAGGAGATTTTGGATTGGCTACAAAACTAGAATATGATGGAGAAAGAAAA
CGCACTATTTGCGGTACTCCTAATTATATAGCTCCTGAAATTTTAGAAGCGAAAGAAACA
GGTCACTCATATGAAGTCGACGTTTGGTCTTTCGGTGTTATTGCATATACTTTACTAATA
GGTAAAAAGTATTTTATATAAAAAGCAAATTACAATTTTAATATTTAAAGATCAATCTTA
ATGTTTTTTTCAAGAGTTTTCAAATCTAAATTATGAAATATTTTTATTTATTAGGTAAAC
CACCTTTTGAAACAAACGACGTAAAATCTACCTACAAGAAAATCAGAACAAATGAATACT
CCTTCCCAGAATAAATTCAAATTTCATCTGCTGCCAAAAATATGATAAAAAAGATTCTCA
CGACTGATCCTTCGAAGAGACCCACTATTAATGAATTATTTAATGACGATTTTTTCAAAA
CAGGTGGATCAATTCCTAAACTGCTACCTGTAAGCACTCTTGCTTGCCCTCCAAGTGCCT
CATATACTCGCTAATTCTTACCTTCAACACAAATTTCTTTATCTACCAATCAAAAATCTA
CAAATTATTAAGTAGAGAATAAGAATAGCTCACCTAAAAAATTTGACAACACAACTCCTA
TTAATGGAAATGGTTTTACACGTTTTGCAACCCAAACTTCCTATAATCCTTAAAATGTAA
AATCTTAATAGTAGATGGGTTTAAAAGAGAGAAAAGACTATATTAATACTTACCGTACAG
GTGGAGCTTAAACAAGTAGCAGTTCAGGTTTATGTAATAGTTAGTATGGCTAAAAGAATT
TTGATACTAATAACGTTAATAACTAAAAAATAGACAACTTTTTGTAAACAAATAAGAACA
CCTATGGGTTAAATGGAAGTGTAGCAAAAGAATAATGCTTCCAAAAAAGTTCTAGTTTAA
ATCCATAAAGTGAAGGTACCACTATCACAAATAATTTAAATTTGGGAATACTCAATTTTG
CTAAAAGTCAAAGTACAAACACTTAATTAGTCGAAAACAGTAACCTCAACAGTTAGAAAA
CAGATAATTATATTCAAAAAATGGATGAATGCAGCCAAAAAGCCTAGCCATAGGTACAAA
ATTCTAATTAACACAAATCAGAAGATTATAGTAAGAATAGTTGCTTAACAAATTAAAAAT
ATACTTCTCAAGCTAGTCATCCTCAAAGTTAAGCAGCTTTAAATTCTGTTTAAAGCCAAG
CTAATATTAAGAATATTAATAATAGTACAAGCATAGCTAATTTTGCTTATAATTAAAGTT
CTGCCGCAATTAACTCAAATACTAATTTGATTTCTACTAACTTAAATAATCTCAGCGGAG
GAGCTAGCTCTATCAGTAATCAGAATTACTTATCTCAAAATAAAAATTATCCTTCATAAT
AATCTACAAATGCAGTATTTAACAGAAACTCAATTGAAAAATATTCTAGCTCAAACAATA
TTAGATCTGGAAATTCTAACTATACTCGTGCTAAATCTGAAAAAATGCATACATAACCTA
CTTCAAGTCTCCTTTAAGCATATGGTTTCACAAAAGTTGAATAAGCTCCTTCTAGTGGAA
CTACTGCCCTTAACTTTAATAATAGTGGCTCTTACTTCTAAGCTCCAGTAAGCTCTAATG
AAGTTCAAATCTAAGGTCCTGATATTTGGGTTTCAAAATGGGTAGACTACTCTTCAAAAT
ACGGTTTAGGCTATCTATTAAATAATGGCTAAGCAGGTGTTTTCTTTAACGACTCAACTA
AGATTATTCTTAATCCAAAAACAGAGTAATTAATTATTTTTTTTTTAAATAAATTTAAAT
TCATAGACTTACTTACATTTCCTTTTAAAATAAAGATAATTTGATTACATCGAGAGAAAT
TCTTCTTCCAAATAAGACTTTGGGGCAGAATATACACTTAAGGATTATCCTGAATCTCTT
TAAAAGAAATTGACTTTGTTATAGCATTTCCGTAGTTTTTTAGAAGGAGAAGACAAGAAA
GCAGATTCTATAAAAATGCCATAGAATGAGGCTAGTGGTGAACCTAAATCTTCTAAAATA
TATGTTAAGAAATGGCTACGTACAAAAAATGCTATCCTTTTCCGTTTGAGCAATAAAGTA
GTTTAAGTTATTTTTTAGGACAGCTCTGAAATTATCTTGAGTAGTGAGCTTCGTGCTGTA
ACTTATGTTAATAGGAAGAAATAAAGAGAAACCTTTCCTCTTAGCACTGCTATGGAGTCA
TAAAACAAAGAAATGTCAAAGCGTCTTACATACACCAAAGATATATTAACTCATATGCTT
AGTGGTAATGTGTAAAGCAAAGGTGAACAATAGAATAATGAAAATATTTCTGTTTAAGAT
CCTACTTCTACTATTACTAATCCAATTGGATTAATAAATTAAAATTAAGATGGTAAAGAG
AAAAACCATTCTAAGAACTAATCAATTAATCCAAATTCTTGCTCTAGTGCAAGTCTTTAC
CCAACTGCAACTACAACTTAATATGCAAATAATAATAGTTCTTCTTAAATTTAACCTTCT
TAAAAGCCTTCGACTAGAGAGAATCTCCACTACTCTAAAAATGTGCCACTCTCTTCTGTA
ACTAACTCTATATATATGCAAAATCAATAGTCTAATCCTATTTATAATAATTACACCTAG
AGTAAATAAATTAAAAACTATAAATAAAATAAATTTTTAACAAATTTTGTATTTTAAATA
GATGAAAATGTTAATGTATTGCTACTTAACAAACAGCAGAGCTTGTAAAATTAAAAGCCT
TCAATTAATGGTAATTCTTTATACAATAAAATTTCTAACTTATTTTAAATTTAATTAATT
TAGGTTATGAGTTAAATGGATTCGCAAGTAGCAATAGTGCAAACAAGAAGGAATCTTTAG
CTACTAATTCTAATATTATAAATAGCACTGAAGGTAAATGCCTTGGACAGCCTTCAAATA
TTTAAAACCTATTAAAGAGTAACTCTACTATTGGTAGAATGAATTCTATGAATCCTACTG
CTACCAGCTCTCTTTCTAATCTAAATAATTTTAATAACTATGTAATGAGTTCACGTAAAA
CTGAAAATTGA