Identifiers and Description

Gene Model Identifier

TTHERM_00683010

Standard Name

PLA1 (PhosphoLipase A)

Aliases

PreTt16138 | 103.m00129 | 3734.m00041

Description

Lysosomal phospholipase A1; extracellular enzyme that may be secreted into the environment as part of an attack and defense system

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 55.3%

TetraMine Data

TTHERM_00683010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17791.19.997093137033517e-262papain family cysteine proteas
e containing protein (322 aa)
OxytrichaContig322.1.g1169.995951036711152e-55Papain family cysteine proteas
e
DictyBaseDDB_G02838672.9994376937714457e-52cprC on chromosome: 4 position
1092858 to 1094270
WormBaseWBGene000007762.000704504372864e-47locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_26281.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11030577: Hartmann M, Guberman A, Florin-Christensen M, Tiedtke A (2000) Screening for and characterization of phospholipase A1 hypersecretory mutants of Tetrahymena thermophila. Applied microbiology and biotechnology 54(3):390-6
  2. Ref:10063621: Guberman A, Hartmann M, Tiedtke A, Florin-Christensen J, Florin-Christensen M (1999) A method for the preparation of Tetrahymena thermophila phospholipase A1 suitable for large-scale production. Journal of applied microbiology 86(2):226-30

Sequences

>TTHERM_00683010(coding)
ATGAACAAGACTCTCATCTTAGCTTTAGTTGGTGTTTTGGCTTTAACTGCCACCACCTTG
GTTGCTTTCCACAACCACTCTCACAACATCAGAGTTGACTAAGACCCCGCCACTCTCTTC
AAGCAATTCAAGCAAACTTACAATAAGAAGTATGCTGATCCTACTTTCGAAACCTACAGA
TTCGGTGTCTTCACCCAAAACTTAGAAATCGTCAAGACTGACTCTACTTTCGGTGTCACC
TAATTCATGGACTTAACTCCTGCTGAATTCGCTCAACAATTCCTCACTTTACACGAAAAG
GTTAACAGCACCGAAGTTTACAGAGCTTAAGGTGAAGCTACCGAAGTTGACTGGACTGCC
AAGGGTAAGGTCACCCCTGTTAAGAACTAAGGTTCTTGTGGTTCCTGCTGGGCTTTCTCC
ACCATTGGTGCCGTTGAATCTGCTCTTTTGATTGCTGGTCAAGGTGAATAAAACACTCTT
AACCTTGCTGAATAAGAATTAGTTGACTGTGCTAAGTCCCCCAAGTACGACTCTGAAGGT
TGCAACGGTGGTTGGATGGTTGAAGGTTTCAAGTACATCATCGACAACAAGATCTCCTAA
ACTGCTAACTATCCCTACACTGCTAAGGATGGTAAGTGCAAGGACACCTCTTCCTTCAAG
AAGTTCTCTATTTCTAAGTACGCTGAAATCCCCTAAGGTGACTGCAACTCCCTCAACTCT
GCCTTAGAACAAGGTCCTATCTCCGTTGCTGTTGATGCCACCAACTTCTAATTCTACACT
TCTGGTGTCTTTAAAAACTGCAAGGCCAACCTCAACCACGGTGTCCTCTTAGTTGCCAAC
GTTGACTCTTCTCTCAAGATCAAGAACTCCTGGGGTCCTTCTTGGGGTGAAAAGGGTTTC
ATCAGATTAGCTGCCGGTAACACTTGCGGTGTCTGCAATGCTGCCTCTTACCCTATTGTT
TGA


>TTHERM_00683010(protein)
MNKTLILALVGVLALTATTLVAFHNHSHNIRVDQDPATLFKQFKQTYNKKYADPTFETYR
FGVFTQNLEIVKTDSTFGVTQFMDLTPAEFAQQFLTLHEKVNSTEVYRAQGEATEVDWTA
KGKVTPVKNQGSCGSCWAFSTIGAVESALLIAGQGEQNTLNLAEQELVDCAKSPKYDSEG
CNGGWMVEGFKYIIDNKISQTANYPYTAKDGKCKDTSSFKKFSISKYAEIPQGDCNSLNS
ALEQGPISVAVDATNFQFYTSGVFKNCKANLNHGVLLVANVDSSLKIKNSWGPSWGEKGF
IRLAAGNTCGVCNAASYPIV


>TTHERM_00683010(gene)
ATGAACAAGACTCTCATCTTAGCTTTAGTTGGTGTTTTGGCTTTAACTGCCACCACCTTG
GTTGCTTTCCACAACCACTCTCACAACATCAGAGTTGACTAAGACCCCGCCACTCTCTTC
AAGCAATTCAAGCAAACTTACAATAAGAAGTATGCTGATCCTACTTTCGAAACCTACAGA
TTCGGTGTCTTCACCCAAAACTTAGAAATCGTCAAGACTGACTCTACTTTCGGTGTCACC
TAATTCATGGACTTAACTCCTGCTGAATTCGCTCAACAATTCCTCACTTTACACGAAAAG
GTTAACAGCACCGAAGTTTACAGAGCTTAAGGTGAAGCTACCGAAGTTGACTGGACTGCC
AAGGGTAAGGTCACCCCTGTTAAGAACTAAGGTTCTTGTGGTTCCTGCTGGGCTTTCTCC
ACCATTGGTGCCGTTGAATCTGCTCTTTTGATTGCTGGTCAAGGTGAATAAAACACTCTT
AACCTTGCTGAATAAGAATTAGTTGACTGTGCTAAGTCCCCCAAGTACGACTCTGAAGGT
TGCAACGGTGGTTGGATGGTTGAAGGTTTCAAGTACATCATCGACAACAAGATCTCCTAA
ACTGCTAACTATCCCTACACTGCTAAGGATGGTAAGTGCAAGGACACCTCTTCCTTCAAG
AAGTTCTCTATTTCTAAGTACGCTGAAATCCCCTAAGGTGACTGCAACTCCCTCAACTCT
GCCTTAGAACAAGGTCCTATCTCCGTTGCTGTTGATGCCACCAACTTCTAATTCTACACT
TCTGGTGTCTTTAAAAACTGCAAGGCCAACCTCAACCACGGTGTCCTCTTAGTTGCCAAC
GTTGACTCTTCTCTCAAGATCAAGAACTCCTGGGGTCCTTCTTGGGGTGAAAAGGGTTTC
ATCAGATTAGCTGCCGGTAACACTTGCGGTGTCTGCAATGCTGCCTCTTACCCTATTGTT
TGA