Identifiers and Description

Gene Model Identifier

TTHERM_00449390

Standard Name

PKD1 (protein kinase domain)

Aliases

PreTt15452 | 52.m00230 | 3811.m00988

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00449390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16860.19.995938456217754e-149protein kinase domain-containi
ng protein (437 aa)
DictyBaseDDB_G02764652.999758165421992e-18sepA on chromosome: 2 position
6942806 to 6946733
OxytrichaContig15160.0.g605.000468829272308e-18Protein kinase domain
WormBaseWBGene000170339.997764199084386e-16locus:nekl-4 Serine/threonin
e-protein kinase D1044.8 sta
tus:Partially_confirmed UniP
rot:P84199 protein_id:CCD683
75.1
SGDYAR019C9.997764199084386e-16CDC15 Protein kinase of the Mi
totic Exit Network that is loc
alized to the spindle pole bod
ies at late anaphase; promotes
mitotic exit by directly swit
ching on the kinase activity o
f Dbf2p; required for spindle
disassembly after meiosis II
Stentor CoeruleusSteCoe_379980.0000000001026187963170189

General Information

Paragraph NoGene NameParagraph Text
35PKD1Tetrahymena thermophila PKD1 (protein kinase domain) is homologous with other protein kinase-like proteins that are involved in catalytic functions and phosphorylation in cellular processes. PKD1 is located near the C-terminus of the protein appears to contain only one known domain (E-value= 1.2x10-42) in the protein kinase family although the substrate specificity of the PKD1 is unknown. Paragraph by: Victoria Nguyen and Joseph Grotts (undergraduates), Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00449390(coding)
ATGGCATTTTAAAGATGCTATATACAACAAAGTGCTTTCTTTTAAATAAAGAAGTTTAAT
TAAAGTAGTATTGTAATTGGCTAAATTATATACCCTTAAACTCTACCGATTTTTTGGAAC
TCTAATGGAATTTCGTCTGAAAATAGTTTTTAGACTGTTTCATAGGAATTAGAGGTTAAT
GGAGATGAAAATGAAAATGATGAATTGGAAGATATTTTAACAAATGGAAATAACAGTTTT
ATAGTGAATACTCAAAAAAATTCTTATGTAATTGAAGATAATTTAATTACTAAAATTTTA
CCTTAAACAAATGTTTACTTATTCTTATATAACCTTCAATTTAATGGTAAATTTTATGAT
GAAATATAAGACATTAGTGAGGAGGTTTAGAAATATGCAGATTTTCCAAAATTCAACTAT
AACTTATAATAAAGAGATTAATATAACAAAATTATGAGTTACAGAGATCCATTTTCTGAA
AATGAACAAAAAATTGAATATGTTTATTAGATCAAATTAAAATATGGATAATTTATTTAA
AAACTTTATCAATAAGAAAATAAAACAAGTCTTTATTTAACTTATACTTCAAATTTTGTT
GTAATATCTTAAATAAATGATGGAGACACAATATCATTTATTTTATCATTTGCTTTTAGT
CTCTTGATATTTAGAAGATCGAAAAAGAGAAAAGAAATTAGAGCTCAAACTGAGGATTTG
ATATATAAATAGGTTATTTAAATTTCTAGATAGGAATTTTAAAAGAAATATGAACTAAAT
TATAGAGATTCTATTGGATGTGGTAGCTTTGGACAGGTCTATAAAGTTAAAAATAAATAT
AAACAAATTATAAAAAATCCTGATATTTTACAAAACATGCCAGATTATTACGCTTGCAAG
CAAATACATATATCTTAAGATGGAGAAAACTAGAGTTAATAGATTTTCCATGAAATCGAA
GTGTTAGAAAAGCTAAAAAAATATGAATATGTAATTAAATTACAAAATTATATTATTGAA
GAAAGGTCAGCATATCTTGTCTTAGATCTAGCAGAGTCCACATTATAGGATAAAATAAAT
GAAAAGTAGGCAAATTCAGAAAAGTTTGATGAGAGCGAAATTGTGAAGTTTTTATCCTAA
ATAGGTAAAACTTTAGCATTAATATACATTGAAGAAGGGATAGCTCATAGAGATATTAAG
CCTTCAAATATACTAATTAAAGATGACAATTTTTACTTATCTGATTTCGGATGTGCAGAA
ATACTATTTGAATCGCAAGAAGCTAGAAACAATTTAGTCATGGGAACTTTAAAATGGATG
TCACCTGAATTAAAAGAAATGAAGAAAAATCAAGTAGTTGACTATTTCAAAAGTGACATA
TTTAGTTTGGGAATGTTATTGCTTTATATGCTTACTCTTTCAGATATTTCTTCTGTAAAC
TCAGATGAGTTTACTAAGAACCAAAAGATAAGAATCATGAAAAATTATTGTAAAGGTATT
TCTAATGAAATAATTTTACTTATAAAAAGAATGTTAGAAACAAACCCTGACAATAGGCCT
GATGCAGCAATAATAATTAATGCAATTTAAGATATAGAAAATAACTTTAAATAAAAAAAT
TTAAGCAAAGATTTATGA


>TTHERM_00449390(protein)
MAFQRCYIQQSAFFQIKKFNQSSIVIGQIIYPQTLPIFWNSNGISSENSFQTVSQELEVN
GDENENDELEDILTNGNNSFIVNTQKNSYVIEDNLITKILPQTNVYLFLYNLQFNGKFYD
EIQDISEEVQKYADFPKFNYNLQQRDQYNKIMSYRDPFSENEQKIEYVYQIKLKYGQFIQ
KLYQQENKTSLYLTYTSNFVVISQINDGDTISFILSFAFSLLIFRRSKKRKEIRAQTEDL
IYKQVIQISRQEFQKKYELNYRDSIGCGSFGQVYKVKNKYKQIIKNPDILQNMPDYYACK
QIHISQDGENQSQQIFHEIEVLEKLKKYEYVIKLQNYIIEERSAYLVLDLAESTLQDKIN
EKQANSEKFDESEIVKFLSQIGKTLALIYIEEGIAHRDIKPSNILIKDDNFYLSDFGCAE
ILFESQEARNNLVMGTLKWMSPELKEMKKNQVVDYFKSDIFSLGMLLLYMLTLSDISSVN
SDEFTKNQKIRIMKNYCKGISNEIILLIKRMLETNPDNRPDAAIIINAIQDIENNFKQKN
LSKDL


>TTHERM_00449390(gene)
ATGGCATTTTAAAGATGCTATATACAACAAAGTGCTTTCTTTTAAATAAAGAAGTTTAAT
TAAAGTAGTATTGTAATTGGCTAAATTATATACCCTTAAACTCTACCGATTTTTTGGAAC
TCTAATGGAATTTCGTCTGAAAATAGTTTTTGTATTTATTAAATATTAGATAATAATTTA
CAGATAAAGTTTTATTATCATTATTAAGAGACTGTTTCATAGGAATTAGAGGTTAATGGA
GGTAATTTGTTTTTTATTAATTAATTTTATGAATAAATAATTAAGTAGAATTAATTTATA
ATTGATTTTTAAAGGGCATAGCTTTAAATTAGGTTAAATATATCGATTTAAATCTGAAGT
ATTTTAAATAAATTTGCTTCATAAAATCATATTATTTTACCAATTATTTTAAAAATTATA
ATTTCAAATATAAAATAATATAAAATATGAATCTTTTGTGTAATAATTCTTTTATTGTAA
ATAAATTAATAAATAAGTGAAGGAGATTTTGCAAGTATCTTAGTCAAATGATAGCTATTA
CTTTTATATTTTAGATAATCAGAATTAGGCTATATTATATTATGTAACTAAAAAACTCAT
TCTTAAATATTTATTGGATGAAAAACCTAAATTAATAAAGACTAATCTATTTACCTAACA
AATGAATAAATGCTTATATAAAATAGATAATATACAGTAGAATTTGTAATAAACAATTAT
TTTTTGTATAGATGAAAATGAAAATGATGAATTGGAAGATATTTTAACAAATGGAAATAA
CAGTTTTATAGTGAATACTCAAAAAAATTCTTATGTAATTGAAGATAATTTAATTACTAA
AATTTTACCTTAAACAAATGTTTACTTATTCTTATATAACCTTCAATTTAATGGTAAATT
TTATGATGAAATATAAGACATTAGTGAGGAGGTTTAGAAATATGCAGATTTTCCAAAATT
CAACTATAACTTATAATAAAGAGATTAATATAACAAAATTATGAGTTACAGAGATCCATT
TTCTGAAAATGAACAAAAAATTGAATATGTTTATTAGATCAAATTAAAATATGGATAATT
TATTTAAAAACTTTATCAATAAGAAAATAAAACAAGTCTTTATTTAACTTATACTTCAAA
TTTTGTTGTAATATCTTAAATAAATGATGGAGACAGTATTTATTAATATTATAGTTTTTT
ACTGAATAATAATCAAAAAGATTTACCTAGCAGCGCATTTATAACTTAATTTGTATATTT
TTAAACAGCAATATCATTTATTTTATCATTTGCTTTTAGTCTCTTGATATTTAGAAGATC
GAAAAAGAGAAAAGAAATTAGAGCTCAAACTGAGGATTTGATATATAAATAGGTTATTTA
AATTTCTAGATAGGAATTTTAAAAGAAATATGAACTAAATTATAGAGATTCTATTGGATG
TGGTAGCTTTGGACAGGTCTATAAAGTTAAAAATAAATATAAACAAATTATAAAAAATCC
TGATATTTTACAAAACATGCCAGATTATTACGCTTGCAAGCAAATACATATATCTTAAGA
TGGAGAAAACTAGAGTTAATAGATTTTCCATGAAATCGAAGTGTTAGAAAAGCTAAAAAA
ATATGAATATGTAATTAAATTACAAAATTATATTATTGAAGAAAGGTCAGCATATCTTGT
CTTAGATCTAGCAGAGTCCACATTATAGGATAAAATAAATGAAAAGTAGGCAAATGTAAG
AAGAAGAATTTTTTTTAATTTTCTTTACTTCATTTTCAAATAAAATTTTGTTTGATATTT
ATTATAGAATTAATATTTTTTTGAATAACTTACTTCAAAAGTTATTTAAACAATACAAAT
TTCTTTTTATTCATAAAATTAATTATCCCAAAACTCAAATTACTACTTTTATTGTTTTTC
TTTTTATATTCAAGATTAAAAATCTTTTTATTGTCTGTCTTACTGTTTTTTACCATAACA
TAACATAAGATAAATTTAAATTTTATTGCTTTGAAAATTTTATAAAATAATTTTGATTAA
TTTAATTAATTACTACTTTCAAAGATTTTATCAATAAATTTCAAGCTCTTTTTGTGTTAA
ATTATTTTTAAGTTATTAAAAATTTAAATTTCATTTAAAAAAATCGAAAAAAAGTCAGAA
AAGTTTGATGAGAGCGAAATTGTGAAGTTTTTATCCTAAATAGGTAAAACTTTAGCATTA
ATATACATTGAAGAAGGGATAGCTCATAGAGATATTAAGCCTTCAAATATACTAATTAAA
GATGACAATTTTTACTTATCTGATTTCGGATGTGCAGAAATACTATTTGAATCGCAAGAA
GCTAGAAACAATTTAGTCATGGGAACTTTAAAATGGATGTCACCTGAATTAAAAGAAATG
AAGAAAAATCAAGTAGTTGACTATTTCAAAAGTGACATATTTAGTTTGGGAATGTTATTG
CTTTATATGCTTACTCTTTCAGATATTTCTTCTGTAAACTCAGATGAGTTTACTAAGAAC
CAAAAGATAAGAATCATGAAAAATTATTGTAAAGGTATTTCTAATGAAATAATTTTACTT
ATAAAAAGAATGTTAGAAACAAACCCTGACAATAGGCCTGATGCAGCAATAATAATTAAT
GCAATTTAAGATATAGAAAATAACTTTAAATAAAAAAATTTAAGCAAAGATTTATGA