Identifiers and Description

Gene Model Identifier

TTHERM_00718040

Standard Name

PKC2 (Protein Kinase C related protein)

Aliases

PreTt10899 | 114.m00134 | 3827.m00977

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00718040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07475.15.001742359316081e-68hypothetical protein (301 aa)
WormBaseWBGene000116127.000924640675686e-24status:Partially_confirmed U
niProt:A4F324 protein_id:CCD
74403.1
OxytrichaContig194.1.g732.000620012690291e-23Protein kinase domain
DictyBaseDDB_G02923901.0002869940498747e-21atg1 on chromosome: 6 position
1694801 to 1697129
SGDYDL101C7.001446474249442e-19DUN1 Cell-cycle checkpoint ser
ine-threonine kinase required
for DNA damage-induced transcr
iption of certain target genes
, phosphorylation of Rad55p an
d Sml1p, and transient G2/M ar
rest after DNA damage; also re
gulates postreplicative DNA re
pair

General Information

Paragraph NoGene NameParagraph Text
30PKC2PKC2 shares homology with a number of Protein Kinase C related proteins in other ciliated prokaryotes. PKC2 contains only one single domain across its entire 517 amino acids. It conserves most of the protein kinase domain, and contains a 241 amino acid region with unknown function. PKC2 appears to play a role in amplifying the message of signal transduction pathways by phosphorylating serine and threonine. This induces a conformational change in a targeted protein and subsequently leads to a cellular response. Paragraph by: Jacqueline Kroll and Rachel Brunetti (undergraduates), Keck Science Department, The Claremont Colleges.

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00718040(coding)
ATGTAAAATAGAATTTTCGTAGGATAAAAGAGTAAATACTAACAAAATAAAAATACTATA
ATATAAGGAGGATAGGCCTAAATATATTTTGCGATTGATTCAAAAAATTATTAGCAGGTA
GTAATTAAAGAATACTTTAAGGATTCAAGCTTTTAAGTAGATTATGAAGTCTTAAAAAAG
ATTTAAGATAAATATTCTGAAAACTTAGAAAATTTAGTCAAAATATATGACTAAAGTAGT
GAAAAGGAAAAAATGAAATTTATAGTAATTGAATACTGCAATGAAGGGGATCTCTATACT
TATCACATTAAAAAATAATAAGAAGTTTAGACATTTGAATAAGCACTAGAAGTTATAGAT
ATTGCAATTTAAATTACTAAAGGAATGATGATATTAAAAGAACTAAACCTAGCGCATAGA
GATTTAAAGCCTGAAAATATATTGATCCATAATGATGGAGAAAAAATTATAGCTAAAATA
TCAGATTATGGACTAACTAAAGAGGTATAAAGAGATTTGAAATCAATTGTAGGAACACCA
AATTATATGGCTCCTGAAATACTATCTGCTTATAAGAAAGGCTCAGTATATGACGATAAA
ATAGACGTTTGGTCTTTTGGATTAATTTTATATGAAATGTTTACTTGCAAATGTTAGTAA
ATTGGTTATAAGATGCCTTTAAAAAGATCCTAAAAATAGACCTGA


>TTHERM_00718040(protein)
MQNRIFVGQKSKYQQNKNTIIQGGQAQIYFAIDSKNYQQVVIKEYFKDSSFQVDYEVLKK
IQDKYSENLENLVKIYDQSSEKEKMKFIVIEYCNEGDLYTYHIKKQQEVQTFEQALEVID
IAIQITKGMMILKELNLAHRDLKPENILIHNDGEKIIAKISDYGLTKEVQRDLKSIVGTP
NYMAPEILSAYKKGSVYDDKIDVWSFGLILYEMFTCKCQQIGYKMPLKRSQKQT


>TTHERM_00718040(gene)
ATGTAAAATAGAATTTTCGTAGGATAAAAGAGTAAATACTAACAAAATAAAAATACTATA
ATATAAGGAGGATAGGCCTAAATATATTTTGCGATTGATTCAAAAAATTATTAGCAGGTA
GTAATTAAAGAATACTTTAAGGATTCAAGTAATACATCATTTTTTATACTTTTTGGTAGC
TTGATTTATGGTAAACGCTAAAATTATTCTTTTAAATAAAAGGCTTTTAAGTAGATTATG
AAGTCTTAAAAAAGATTTAAGATAAATATTCTGAAAACTTAGAAAATTTAGTCAAAATAT
ATGACTAAAGTAGTGAAAAGGAAAAAATGAAATTTATAGTAATTGAATACTGCAATGAAG
GGGATCTCTATACTTATCACATTAAAAAATAATAAGAAGTTTAGACATTTGAATAAGCAC
TAGAAGTTATAGATATTGCAATTTAAATTACTAAAGGAATGATGATATTAAAAGAACTAA
ACCTAGCGCATAGAGATTTAAAGCCTGAAAATATATTGATCCATAATGATGGAGAAAAAA
TTATAGCTAAAATATCAGATTATGGACTAACTAAAGAGGTATAAAGAGATTTGAAATCAA
TTGTAGGAACACCAAATTATATGGCTCCTGAAATACTATCTGCTTATAAGAAAGGCTCAG
TATATGACGATAAAATAGACGTTTGGTCTTTTGGATTAATTTTATATGAAATGTTTACTT
GCAAGTAAATATTTAAAGGTGATTAAAAATAGATCTTTAATTAACTCATTCACTACAATG
ACATAATTGATTAACTTTTATTTTAAGATAAATTTTAAGATGTTAGTAAATTGGTTATAA
GATGCCTTTAAAAAGATCCTAAAAATAGACCTGA