Identifiers and Description

Gene Model Identifier

TTHERM_00046730

Standard Name

PHR2 (PHotolyase Repair 2)

Aliases

PreTt11152 | 3.m01856 | 3824.m02913

Description

FAD binding domain of DNA photolyase family protein; utilizes blue light to repair DNA function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00046730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01777.19.997093137033517e-262FAD binding domain-DNA photoly
ase (489 aa)
SGDYOR386W1.9994274381022833e-63PHR1 DNA photolyase involved i
n photoreactivation, repairs p
yrimidine dimers in the presen
ce of visible light; induced b
y DNA damage; regulated by tra
nscriptional repressor Rph1p
OxytrichaContig17048.0.g642.0003218023735366e-33FAD binding domain of DNA phot
olyase

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000179
  2. Ref:SUPR000169

Sequences

>TTHERM_00046730(coding)
ATGAGCTAGAATAAAAATCAATATAAAAAAGAAGAATATCCCTTAAAAACCTCTAAAAGA
AAGAGGGAAGCATTTGAGGAAGGATAAGCTGAGTCAAAGATGATTGAAGAAGATGATGGA
AAATCAAGTAAAAAATAACAAGACAAAAACGCTAAGCAAAAGAGGAAAGTTAGCATATTC
TGGTTTAGAAGAGATCTTAGATTAAACGATAACACTGCTTTATATAACGCCTTAAAGTCT
CAAAATGAAGTTGTACCTTTGTTTATTTTTGACACTGAAATTTTAGACAAATTAGAAGAT
AAAAAAGACGCTCGAGTTGAATTCATACACTTATATATTATGAAAATCTAAGAATAACTA
AAATAAGTTGGATCTACCCTAATTGTGAAACATGGTACAGTTGACAATGCTTTTAAAGAG
CTTGTTTCGGAGTTTGATATTTAAAGTGTTTATGTAAATAGAGATTATGAATCTTCTGCT
AAATAAAGAGATGAAAGGATTAAAAAATATGTCAAATAATCAGCAAATGCTGAGTTTTAC
GATTTTAAGGATCAAGTTATTTTTGAAGCCAGTTCAACCAATAAAGATGGATCACCTTAT
AAAGTTTTCACACCATATAGCAAAAAATGGCTGAGTATATTGACTTCAGAAGACTACTCT
TGTAGACCTTCTGAATCATTAATGGAAAAATTTTGGAAATCTCCTGAAAGAAAAGTTATG
AGTTTAGAAGAAATTGGATTTGAGAAAGCAGGAATTCCTTTTCCATCTGTTGAGTTGAAT
GAAAAAATTGTTAAGAATTATGATAAGACTCGTGATACACCTTCAATAGAAGGTACCACG
AGAATGAGTGTTCATTTAAGATTTGGTACAGTTTCAATTAGGGATTTAGTTAGGAGATCA
AAAGGTTTAAATGCTACATATCTAAATGAACTTATATGGCGTGATTTTTATATGATGATT
TTAGATTAATTTCCACATGTAGAGAACAATAATTTTAAACCAGCATATGATAAACTAGTT
TGGAGAAATAATGTAGATGAATTTATGGCTTGGTGCGAAGGCAAAACAGGATATCATTTG
GTTGATGCTGGAATGAGATAATTAAATTAGACAGGTTATATGCATAATAGAGTTAGAATG
GTTGTAGCAAGCTTCTTAACAAAGCATTTATTAATTGATTGGAAATGGGGTGAAAGATAT
TTTGCCTCTAAACTTTTAGATTATGACTTATCTGCAAATAATGGTGGATGGCAATGGGCA
GCAGGAACAGGTACAGATGCTTAACCTTATTTTAGAATATTTAATCCTGATAGCTAATAA
AAAAAATTTGATCCTAATTATACTTATATTAAAACATGGATAAAAGATTTAAATACTAAA
ACATATCCCAAGCCTATTGTTGACCATAAATTGGCAAGAGAGCGTTGCTTATAAGCTTTC
AAAAAAGCTTTAGGATAATGA


>TTHERM_00046730(protein)
MSQNKNQYKKEEYPLKTSKRKREAFEEGQAESKMIEEDDGKSSKKQQDKNAKQKRKVSIF
WFRRDLRLNDNTALYNALKSQNEVVPLFIFDTEILDKLEDKKDARVEFIHLYIMKIQEQL
KQVGSTLIVKHGTVDNAFKELVSEFDIQSVYVNRDYESSAKQRDERIKKYVKQSANAEFY
DFKDQVIFEASSTNKDGSPYKVFTPYSKKWLSILTSEDYSCRPSESLMEKFWKSPERKVM
SLEEIGFEKAGIPFPSVELNEKIVKNYDKTRDTPSIEGTTRMSVHLRFGTVSIRDLVRRS
KGLNATYLNELIWRDFYMMILDQFPHVENNNFKPAYDKLVWRNNVDEFMAWCEGKTGYHL
VDAGMRQLNQTGYMHNRVRMVVASFLTKHLLIDWKWGERYFASKLLDYDLSANNGGWQWA
AGTGTDAQPYFRIFNPDSQQKKFDPNYTYIKTWIKDLNTKTYPKPIVDHKLARERCLQAF
KKALGQ


>TTHERM_00046730(gene)
ATGAGCTAGAATAAAAATCAATATAAAAAAGAAGAATATCCCTTAAAAACCTCTAAAAGA
AAGAGGGAAGCATTTGAGGAAGGATAAGCTGAGTCAAAGATGATTGAAGAAGATGATGGA
AAATCAAGTAAAAAATAACAAGACAAAAACGCTAAGCAAAAGTATGTTTTTATATAATTT
TTATAATTAAAAAAGAAATCTAAAAGTAGAAAGAAATCATGTAGAATTTACATAAAATTA
AAATACCGAAACATATTTTTAATAGAACTTAAACTTTTTTCTTAAATGCTACTTAATAAT
ATTATTTCCATTCAATTAACAACAATATTAGGAGGAAAGTTAGCATATTCTGGTTTAGAA
GAGATCTTAGATTAAACGATAACACTGCTTTATATAACGCCTTAAAGTCTCAAAATGAAG
TTGTACCTTTGTTTATTTTTGACACTGAAATTTTAGACAAATTAGAAGATAAAAAAGACG
CTCGAGTTGAATTCATACACTTATATATTATGAAAATCTAAGAATAACTAAAATAAGTTG
GATCTACCCTAATTGTGAAACATGGTACAGTTGACAATGCTTTTAAAGAGCTTGTTTCGG
AGTTTGATATTTAAAGTGTTTATGTAAATAGAGATTATGAATCTTCTGCTAAATAAAGAG
ATGAAAGGATTAAAAAATATGTCAAATAATCAGCAAATGCTGAGTTTTACGATTTTAAGG
ATCAAGTTATTTTTGAAGCCAGTTCAACCAATAAAGATGGATCACCTTATAAAGTTTTCA
CACCATATAGCAAAAAATGGCTGAGTATATTGACTTCAGAAGACTACTCTTGTAGACCTT
CTGAATCATTAATGGAAAAATTTTGGAAATCTCCTGAAAGAAAAGTTATGAGTTTAGAAG
AAATTGGATTTGAGAAAGCAGGAATTGTAATCTTTTTTATTAAATATTTAATTAATTATA
AAAAAAAACAGATAGAATAAATAAATTATTCATAAAAATTAATTAATTTAAAATATAAAG
CCTTTTCCATCTGTTGAGTTGAATGAAAAAATTGTTAAGAATTATGATAAGACTCGTGAT
ACACCTTCAATAGAAGGTACCACGAGAATGAGTGTTCATTTAAGATTTGGTACAGTTTCA
ATTAGGGATTTAGTTAGGAGATCAAAAGGTTTAAATGCTACATATCTAAATGAACTTATA
TGGCGTGATTTTTATATGATGATTTTAGATTAATTTCCACATGTAGAGAACAATAATTTT
AAACCAGCATATGATAAACTAGTTTGGAGAAATAATGTAGATGAATTTATGGCTTGGTGC
GAAGGCAAAACAGGTAAAATGTCATTTTATTAATATAATTATTTAAATTATTATTCTTTT
TAGAAATTAAATTAAATTACTTAATTAGTTAGTTAGCTTACAAGCTTAAGAAAATAATTT
TATAACATTTAGCTAATTAAAATTTATTTATAAAGCATTTTTAAATATAATTTAAAGGAT
ATCATTTGGTTGATGCTGGAATGAGATAATTAAATTAGACAGGTTATATGCATAATAGAG
TTAGAATGGTTGTAGCAAGCTTCTTAACAAAGCATTTATTAATTGATTGGAAATGGGGTG
AAAGATATTTTGCCTCTAAACTTTTAGATTATGACTTATCTGCAAATAATGGTGGATGGC
AATGGGCAGCAGGAACAGGTACAGATGCTTAACCTTATTTTAGAATATTTAATCCTGATA
GCTAATAAAAAAAATTTGATCCTAATTATACTTATATTAAAACATGGATAAAAGATTTAA
ATACTAAAACATATCCCAAGCCTATTGTTGACCATAAATTGGCAAGAGAGCGTTGCTTAT
AAGCTTTCAAAAAAGCTTTAGGATAATGA