Identifiers and Description

Gene Model Identifier

TTHERM_00640040

Standard Name

PHR1 (PHotolyase Repair 1)

Aliases

PreTt10572 | 92.m00114

Description

FAD binding domain of DNA photolyase family protein; utilizes visible light and long wavelength UV light to repair cyclobutane pyrimidine dimers

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02765 ) cryptochrome, DASH family
  • ( TIGR02766 ) cryptochrome, plant family
  • ( PF00875 ) deoxyribodipyrimidine photolyase
  • ( TIGR00591 ) deoxyribodipyrimidine photolyase
  • ( PF03441 ) FAD binding domain of DNA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00640040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01777.19.997093137033517e-262FAD binding domain-DNA photoly
ase (489 aa)
SGDYOR386W9.999353957415832e-59PHR1 DNA photolyase involved i
n photoreactivation, repairs p
yrimidine dimers in the presen
ce of visible light; induced b
y DNA damage; regulated by tra
nscriptional repressor Rph1p
OxytrichaContig17048.0.g648.001655364039598e-37FAD binding domain of DNA phot
olyase

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000230
  2. Ref:SUPR000195
  3. Ref:SUPR000125

Sequences

>TTHERM_00640040(coding)
ATGGATATATTAAATAGCAAATAATTTAGTGAAAATCAAAAGAAACAAAAAGTGAATTTG
TTTTGGTTTAGAAGAGATCTTAGATTATTTGACAACGTTGGGCTTTATCATGCTTTAAAG
GAATCTATACCTGTCGTACCTCTGTTTATATTTGACAAAGACATTTTAAATGAGCTCGAA
GATAAAAAGGATTGCAGAGTAGAATTCATTCATAATTATTTGAGTTAAATGTAAGATAAC
CTTAGAAAACATGGATCAACAATGGTTGTCAAACATTCTAATGCAGAAAGTGCTTTCAAG
AGTCTTATGGAGGAATTTGATATCTCTTGTGTATTCACAAACAGAGACTATGAACCATAC
GCAAAAAAGAGAGATTAATAGATTAAAGAGATACTAAACAGTAAAGGAATAGGATTCAAA
GATTTTAAGGACTAGGTTATTTTTGAAGCTAAAGAAGTACATCAAGACGATGGAAGTGCA
TTTAAGGTCTATACTCCTTTCAGTAAAAAATGGATCTCTTTACTTAGTGAACCTGATTAT
TAGAGTTACAAATCAGAGTCACTCATGAATAATTACTGGAAAAGCTAAGTAGAAGTTCCT
TTTCCTACTTTAGAATAGATAGGGTTTTAAAAAACAGGAATAGAGTTTCCACCAAGCTAG
TTAGATGAAGAATTGGTTAAAAATTATGATAAGACAAGAGATTACCCTCACATTAAAACA
TCTTTGATGAGTGTTCATTTGAGATTTGGCACTGTTTCTATCAGAGAGCTTGTTAGGAAA
GCCGTTCTCCTTAATTAGAAATATCTTGATGAGCTCTGCTGGAGAGAGTTCTTTATGATG
ATGATAGATTAGTTTCCTCTATTTGCTACAGAAAATTTCAAAAAGGCTTATAATAAAGTA
GAATGGAGAAACAACCCAGAGGAGTTTAAGGCATGGTGCGAAGGCAAAACTGGTTACCCT
TTATTAGATGCAGGAATGAGGTAACTAAATAAAACAGGTTACTTACCTAATAAGCTTAGA
ATGATTGCTGCAAGCTTCTTAACTAAAAATTTACTTATCGATTGGAGATGGGGCGAGAGG
TACTTTGCCTAAAAGTTAATAGATTACGACCTAGCAGCTAATGTAGGAGGATGGCAGTGG
GTAAATGGTTCAGGAACAGACTAAGCCCCATACATTAGAGTATTAGATCCTGTAATGCAA
CAAAAAAAGTATGATCCTGATTTCAAATACGTTAAAACTTGGGTTGAAGATTTTAATGAA
GATACCTACCCAAAAAGAATTGTTAACTATGAAGAGTCAAGACAAAGAGCCCTAGATGCT
TTCTCAATAGTTTTCAAAAAAAATTAAATTAAGCAGCATTAGCAATAAATAAAGGAAAAA
AAAGCAAATTATTAGCACTATTATAAAAATAAAAAATGA


>TTHERM_00640040(protein)
MDILNSKQFSENQKKQKVNLFWFRRDLRLFDNVGLYHALKESIPVVPLFIFDKDILNELE
DKKDCRVEFIHNYLSQMQDNLRKHGSTMVVKHSNAESAFKSLMEEFDISCVFTNRDYEPY
AKKRDQQIKEILNSKGIGFKDFKDQVIFEAKEVHQDDGSAFKVYTPFSKKWISLLSEPDY
QSYKSESLMNNYWKSQVEVPFPTLEQIGFQKTGIEFPPSQLDEELVKNYDKTRDYPHIKT
SLMSVHLRFGTVSIRELVRKAVLLNQKYLDELCWREFFMMMIDQFPLFATENFKKAYNKV
EWRNNPEEFKAWCEGKTGYPLLDAGMRQLNKTGYLPNKLRMIAASFLTKNLLIDWRWGER
YFAQKLIDYDLAANVGGWQWVNGSGTDQAPYIRVLDPVMQQKKYDPDFKYVKTWVEDFNE
DTYPKRIVNYEESRQRALDAFSIVFKKNQIKQHQQQIKEKKANYQHYYKNKK


>TTHERM_00640040(gene)
ATGGATATATTAAATAGCAAATAATTTAGTGAAAATCAAAAGAAACAAAAAGTGAATTTG
TTTTGGTTTAGAAGAGATCTTAGATTATTTGACAACGTTGGGCTTTATCATGCTTTAAAG
GAATCTATACCTGTCGTACCTCTGTTTATATTTGACAAAGACATTTTAAATGAGCTCGAA
GATAAAAAGGATTGCAGAGTAGAATTCATTCATAATTATTTGAGTTAAATGTAAGATAAC
CTTAGAAAACATGGATCAACAATGGTTGTCAAACATTCTAATGCAGAAAGTGCTTTCAAG
AGTCTTATGGAGGAATTTGATATCTCTTGTGTATTCACAAACAGAGACTATGAACCATAC
GCAAAAAAGAGAGATTAATAGATTAAAGAGATACTAAACAGTAAAGGAATAGGATTCAAA
GATTTTAAGGACTAGGTTATTTTTGAAGCTAAAGAAGTACATCAAGACGATGGAAGTGCA
TTTAAGGTCTATACTCCTTTCAGTAAAAAATGGATCTCTTTACTTAGTGAACCTGATTAT
TAGAGTTACAAATCAGAGTCACTCATGAATAATTACTGGAAAAGCTAAGTAGAAGTTCCT
TTTCCTACTTTAGAATAGATAGGGTTTTAAAAAACAGGAATAGAGTTTCCACCAAGCTAG
TTAGATGAAGAATTGGTTAAAAATTATGATAAGACAAGAGATTACCCTCACATTAAAACA
TCTTTGATGAGTGTTCATTTGAGATTTGGCACTGTTTCTATCAGAGAGCTTGTTAGGAAA
GCCGTTCTCCTTAATTAGAAATATCTTGATGAGCTCTGCTGGAGAGAGTTCTTTATGATG
ATGATAGATTAGTTTCCTCTATTTGCTACAGAAAATTTCAAAAAGGCTTATAATAAAGTA
GAATGGAGAAACAACCCAGAGGAGTTTAAGGCATGGTGCGAAGGCAAAACTGGTTACCCT
TTATTAGATGCAGGAATGAGGTAACTAAATAAAACAGGTTACTTACCTAATAAGCTTAGA
ATGATTGCTGCAAGCTTCTTAACTAAAAATTTACTTATCGATTGGAGATGGGGCGAGAGG
TACTTTGCCTAAAAGTTAATAGATTACGACCTAGCAGCTAATGTAGGAGGATGGCAGTGG
GTAAATGGTTCAGGAACAGACTAAGCCCCATACATTAGAGTATTAGATCCTGTAATGCAA
CAAAAAAAGTATGATCCTGATTTCAAATACGTTAAAACTTGGGTTGAAGATTTTAATGAA
GATACCTACCCAAAAAGAATTGTTAACTATGAAGAGTCAAGACAAAGAGCCCTAGATGCT
TTCTCAATAGTTTTCAAAAAAAATTAAATTAAGCAGCATTAGCAATAAATAAAGGAAAAA
AAAGCAAATTATTAGCACTATTATAAAAATAAAAAATGA