Identifiers and Description

Gene Model Identifier

TTHERM_00577080

Standard Name

PGM1 (PhosphoGlucoMutase )

Aliases

PreTt28995 | 77.m00207 | 3812.m02684

Description

PGM1 cytoplasmic phosphoglucomutase; Phosphoglucomutase; carbohydrate metabolism enzyme that catalyzes the conversion of alpha-D-glucose 1-phosphate into alpha-D-glucose 6-phosphate; knock-out mutants have no defects in growth- morphology or exocytosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00577080

WebApollo

Fullscreen View

Tetrahymena Stock Center

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_119760
Tetrahymena borealisEI9_04065.19.997093137033517e-262phosphoglucomutase/phosphomann
omutase domain-containing prot
ein (588 aa)
DictyBaseDDB_G02884839.997093137033517e-262pgmA on chromosome: 5 position
1620141 to 1621859
OxytrichaContig15616.0.g439.997093137033517e-262Phosphoglucomutase/phosphomann
omutase, alpha/beta/alpha doma
in I
WormBaseWBGene000198901.9999987447608204e-178status:Confirmed UniProt:Q21
742 protein_id:CCD69274.1
SGDYMR105C3.999622461503957e-161PGM2 Phosphoglucomutase, catal
yzes the conversion from gluco
se-1-phosphate to glucose-6-ph
osphate, which is a key step i
n hexose metabolism; functions
as the acceptor for a Glc-pho
sphotransferase

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9382866: Chilcoat ND, Turkewitz AP (1997) In vivo analysis of the major exocytosis-sensitive phosphoprotein in Tetrahymena. The Journal of cell biology 139(5):1197-207
  2. Ref:8582637: Huvos P (1995) Developmental DNA rearrangements and micronucleus-specific sequences in five species within the Tetrahymena pyriformis species complex. Genetics 141(3):925-36

Sequences

>TTHERM_00577080(coding)
ATGGATACCCATCATACAATTGTTCATAAGGAACCCATCACTGTTTAAGTTGTTCAAACC
AAGCCTTTTGCTGGTTAGAAACCTGGTACTTCTGGACTTCGTAAAAAGGTTAGTGTTGTT
AAGGAGGCTCATTACTTAGAAAATTTCGTAAGCTCAGTCTTTAAAACCATTCCCAGCGAA
GAATTTACAAAGGAAAACATCTTGGTTGTTGGTGGTGATGGCAGATATTTCAACAAAGAA
GCCATCGATATCATCATTAAAATTGCTGCTGCAGAAGGTGTTGATCACATTCACGTCGCT
CATACTGGTTTAATGTCCACTCCTGCTGTCTCTGCTTACGTCAGACATTTGAATCTCGAC
TTGAAGCTTAACTGCATTGGTGCTTTTATCTTAACTGCTTCTCACAATCCTGGTGGTCCA
ACTAACGATTTTGGTATCAAATTCAATGTTAGAAATGGTGGTCCAGCTCTTGAAGACTTC
ACTAACACCATCTACAAGCACACTACTGAAATAACTTCTTACAAGATTGCTCATGGTGAA
ATAAAGTATGATTTACACAAGATATAAGAGTACGTTTTCGAAAATGTAGAAAGAGAATCA
AAGAGACCTAAATTCACTATCAAGGTTGTAGACTCAACTGAAAATTACATTAATTTAATG
AAAACCCTCTTCGACTTTGATAAATTGAAGAAACTTTTCTAAAGAAAGGACTTCTAGTTC
CGTTTCGATGGCATGCATGGTGTCGCTGGACCTTATGCTCATAAAATCTTCCATGAAATT
CTTGGTGCTCACACTGATAATTTGATTAACTGTAACCCTAAAGAAGACTTTGGTGGTGGT
CATCCCGATCCTAACCTCACCTATGCTGAGCATCTTGTTAAAATTATGGATGTCCACAAC
ATGATTAATACTATTGCAGAAAGAATTCCCAATTTTGGTGCTGCATGTGATGGTGATGCT
GATAGAAATATGATCTTAGGAAGACGTTTCTTTGTTACTCCTAGTGATTCTGTTGCTGTC
TTGGCTGCTAATGCTAGCTCCGTATTTGGTAAGAATGGACATCTTTTAGGTGTTGCCCGT
TCCATGCCTACATCTGGTGCTCTTGATAAGGTAGCTGCCAAGCTTGGAATCAAAAACCTT
TATGAAACTCCCACTGGATGGAAGTTCTTTGGTAACTTGATGGATGCTGGAAAAATTAAT
ATTTGCGGAGAAGAAAGCTTTGGTACTGGTTCTAATCACATTAGAGAAAAGGATGGTATT
TGGGCTATTTTAGCATGGTTGAGCGTTATTGCTGACAGAAACGTAGACAAAACTTAAGAA
GGTCATCTTATCGGAGTTTAATAAATAGTCGAAGAATTCTGGAAGACTTATGGAAGAAAC
TACTATTCTAGATACGATTATGAAGGAGTTGATGCCGATGCTGCCAATAAAGTTATGGCT
CATCTTGAAACCCAATTCAAGCACTTCGAAGAATTATAGAAAGGTAATGTTGCTGATATT
TTCAACTATACTGATCCTGTTGATGGATCTGTTAGCAAGAACTAAGGTATTAGATTTATC
TACGCCGATGGTTCTAGAATCATTTTCAGATTAAGTGGTACTGGTTCTGAAGGAGCTACA
ATTAGAATTTACTTTGAAAAGTATGAAGCTACTGATATTGATCAAAGAACTGATTTAGCC
TTAGAAGAAATAATAAATTTAGGTCTCTAACTTTCTAAGATTTCTGAATTCACTGGAAGA
AATGAACCTACTGTTATCACATGA


>TTHERM_00577080(protein)
MDTHHTIVHKEPITVQVVQTKPFAGQKPGTSGLRKKVSVVKEAHYLENFVSSVFKTIPSE
EFTKENILVVGGDGRYFNKEAIDIIIKIAAAEGVDHIHVAHTGLMSTPAVSAYVRHLNLD
LKLNCIGAFILTASHNPGGPTNDFGIKFNVRNGGPALEDFTNTIYKHTTEITSYKIAHGE
IKYDLHKIQEYVFENVERESKRPKFTIKVVDSTENYINLMKTLFDFDKLKKLFQRKDFQF
RFDGMHGVAGPYAHKIFHEILGAHTDNLINCNPKEDFGGGHPDPNLTYAEHLVKIMDVHN
MINTIAERIPNFGAACDGDADRNMILGRRFFVTPSDSVAVLAANASSVFGKNGHLLGVAR
SMPTSGALDKVAAKLGIKNLYETPTGWKFFGNLMDAGKINICGEESFGTGSNHIREKDGI
WAILAWLSVIADRNVDKTQEGHLIGVQQIVEEFWKTYGRNYYSRYDYEGVDADAANKVMA
HLETQFKHFEELQKGNVADIFNYTDPVDGSVSKNQGIRFIYADGSRIIFRLSGTGSEGAT
IRIYFEKYEATDIDQRTDLALEEIINLGLQLSKISEFTGRNEPTVIT


>TTHERM_00577080(gene)
ATGGATACCCATCATACAATTGTTCATAAGGAACCCATCACTGTTTAAGTTGTTCAAACC
AAGCCTTTTGCTGGTTAGAAACCTGGTACTTCTGGACTTCGTAAAAAGGTAAATTCAAAT
AAGCATAATATATTAACTTAGTCATAGCTATTTCATTTACTCAGCTATTTTATTCATGAC
CCAATTAATTGCATTAAAATAGGTTAGTGTTGTTAAGGAGGCTCATTACTTAGAAAATTT
CGTAAGCTCAGTCTTTAAAACCATTCCCAGCGAAGAATTTACAAGTAAATAATATTTGTT
TTAGCTTAAATATAGATATTCATGCCTATTTATGTATAATTAGAGGAAAACATCTTGGTT
GTTGGTGGTGATGGCAGATATTTCAACAAAGAAGCCATCGATATCATCATTAAAATTGCT
GCTGCAGAAGGTGTTGATCACATTCACGTCGCTCATACTGGTTTAATGTCCACTCCTGCT
GTCTCTGCTTACGTCAGACATTTGAATCTCGACTTGAAGCTTAACTGCATTGGTGCTTTT
ATCTTAACTGCTTCTCACAATCCTGGTGGTCCAACTAACGATTTTGGTATCAAATTCAAT
GTTAGAAATGGTGGTCCAGCTCTTGAAGACTTCACTAACACCATCTACAAGCACACTACT
GAAATAACTTCTTACAAGATTGCTCATGGTGAAATAAAGGTAAAATCTTCATGAAATTCT
TCATTTAATAATTCCCTAATCTCCAAACAAATGATCAGAAATCTTATATAAAATAACCAA
AAATGATAAAAGGTTAAAGTAAATAAAACAGATTATCACATTTAATAAGAAGGCTAATAG
AATATTACAATAAGAACTATTAATATAATTTAAATAAATTATTTTCAAATAAATCAATTA
ATTAACATTTTTTAAATTTTACTAGTATGATTTACACAAGATATAAGAGTACGTTTTCGA
AAATGTAGAAAGAGAATCAAAGAGACCTAAATTCACTATCAAGGTTGTAGACTCAACTGA
AAATTACATTAATTTAATGAAAACCCTCTTCGACTTTGATAAATTGAAGAAACTTTTCTA
AAGAAAGGACTTCTAGTTCCGTTTCGATGGCATGCATGGTGTCGCTGGACCTTATGCTCA
TAAAATCTTCCATGAAATTCTTGGTGCTCACACTGATAATTTGATTAACTGTAACCCTAA
AGAAGACTTTGGTGGTGGTCATCCCGATCCTAACCTCACCTATGCTGAGCATCTTGTTAA
AATTATGGATGTCCACAACATGGTAATAAAATTATTTGAATTTTTAATTAAAAAATTTGA
AAAGCTAGATCAGAAAATAAATAGATATAGTAGTAGAACTAATTTATTAAATTTTAATAT
TAGCTATTTAGTTTGTAAGCAAGCAAGGATAGGATATTAATAATTTTTTAATAGTCCTTT
GATATTTAATTAAAAAAGCTTAAATTTTAAAATAAAAAGCTTAATAAAATAAAAGCAATA
CCCTATTCTAAATAAAAATTTTATTAAAAAAAGATTAATACTATTGCAGAAAGAATTCCC
AATTTTGGTGCTGCATGTGATGGTGATGCTGATAGAAATATGATCTTAGGAAGACGTTTC
TTTGTTACTCCTAGTGATTCTGTTGCTGTCTTGGCTGCTAATGCTAGCTCCGTATTTGGT
AAGAATGGACATCTTTTAGGTGTTGCCCGTTCCATGCCTACATCTGGTGCTCTTGATAAG
GTAGCTGCCAAGCTTGGAATCAAAAACCTTTATGAAACTCCCACTGGATGGAAGTTCTTT
GGTAACTTGATGGATGCTGGAAAAATTAATATTTGCGGAGAAGAAAGCTTTGGTACTGGT
TCTAATCACATTAGAGAAAAGGTATTTAACTTTTTAATATAAATTAATTTTAATCTTCTA
ATTAATTATTTTGATAGGATGGTATTTGGGCTATTTTAGCATGGTTGAGCGTTATTGCTG
ACAGAAACGTAGACAAAACTTAAGAAGGTCATCTTATCGGAGTTTAATAAATAGTCGAAG
AATTCTGGAAGACTTATGGAAGAAACTACTATTCTAGATACGATTATGAAGGAGTTGATG
CCGATGCTGCCAATAAAGTTATGGCTCATCTTGAAACCCAATTCAAGCACTTCGAAGTAA
TAAATAACAATAATTTACTTTGAAATGTTTAAAAATCTAAATGAATTAAAGATTAAATTC
ATTTCGATTAATTAACTATTTTTCACGATAAAAATTGCTTAACTTATCAATTTTAATTTA
TTAATAGGAATTATAGAAAGGTAATGTTGCTGATATTTTCAACTATACTGATCCTGTTGA
TGGATCTGTTAGCAAGAACTAAGGTATTAGATTTATCTACGCCGATGGTTCTAGAATCAT
TTTCAGATTAAGTGGTACTGGTTCTGAAGGAGCTACAATTAGAATTTACTTTGAAAAGTA
TGAAGCTACTGATATTGATCAAAGAACTGATTTAGCCTTAGAAGAAATAATAAATTTAGG
TCTCTAACTTTCTAAGATTTCTGAATTCACTGGAAGAAATGAACCTACTGTTATCACATG
A