Identifiers and Description

Gene Model Identifier

TTHERM_00577080

Standard Name

PGM1 (PhosphoGlucoMutase )

Aliases

PreTt28995 | 77.m00207 | 3812.m02684

Description

Phosphoglucomutase; carbohydrate metabolism enzyme that catalyzes the conversion of alpha-D-glucose 1-phosphate into alpha-D-glucose 6-phosphate; knock-out mutants have no defects in growth, morphology or exocytosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00577080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_119760
Tetrahymena borealisEI9_04065.19.997093137033517e-262phosphoglucomutase/phosphomann
omutase domain-containing prot
ein (588 aa)
DictyBaseDDB_G02884839.997093137033517e-262pgmA on chromosome: 5 position
1620141 to 1621859
OxytrichaContig15616.0.g439.997093137033517e-262Phosphoglucomutase/phosphomann
omutase, alpha/beta/alpha doma
in I
WormBaseWBGene000198901.9999987447608204e-178status:Confirmed UniProt:Q21
742 protein_id:CCD69274.1
SGDYMR105C3.999622461503957e-161PGM2 Phosphoglucomutase, catal
yzes the conversion from gluco
se-1-phosphate to glucose-6-ph
osphate, which is a key step i
n hexose metabolism; functions
as the acceptor for a Glc-pho
sphotransferase

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9382866: Chilcoat ND, Turkewitz AP (1997) In vivo analysis of the major exocytosis-sensitive phosphoprotein in Tetrahymena. The Journal of cell biology 139(5):1197-207

Sequences

>TTHERM_00577080(coding)
ATGGATACCCATCATACAATTGTTCATAAGGAACCCATCACTGTTTAAGTTGTTCAAACC
AAGCCTTTTGCTGGTTAGAAACCTGGTACTTCTGGACTTCGTAAAAAGGTTAGTGTTGTT
AAGGAGGCTCATTACTTAGAAAATTTCGTAAGCTCAGTCTTTAAAACCATTCCCAGCGAA
GAATTTACAAAGGAAAACATCTTGGTTGTTGGTGGTGATGGCAGATATTTCAACAAAGAA
GCCATCGATATCATCATTAAAATTGCTGCTGCAGAAGGTGTTGATCACATTCACGTCGCT
CATACTGGTTTAATGTCCACTCCTGCTGTCTCTGCTTACGTCAGACATTTGAATCTCGAC
TTGAAGCTTAACTGCATTGGTGCTTTTATCTTAACTGCTTCTCACAATCCTGGTGGTCCA
ACTAACGATTTTGGTATCAAATTCAATGTTAGAAATGGTGGTCCAGCTCTTGAAGACTTC
ACTAACACCATCTACAAGCACACTACTGAAATAACTTCTTACAAGATTGCTCATGGTGAA
ATAAAGTATGATTTACACAAGATATAAGAGTACGTTTTCGAAAATGTAGAAAGAGAATCA
AAGAGACCTAAATTCACTATCAAGGTTGTAGACTCAACTGAAAATTACATTAATTTAATG
AAAACCCTCTTCGACTTTGATAAATTGAAGAAACTTTTCTAAAGAAAGGACTTCTAGTTC
CGTTTCGATGGCATGCATGGTGTCGCTGGACCTTATGCTCATAAAATCTTCCATGAAATT
CTTGGTGCTCACACTGATAATTTGATTAACTGTAACCCTAAAGAAGACTTTGGTGGTGGT
CATCCCGATCCTAACCTCACCTATGCTGAGCATCTTGTTAAAATTATGGATGTCCACAAC
ATGATTAATACTATTGCAGAAAGAATTCCCAATTTTGGTGCTGCATGTGATGGTGATGCT
GATAGAAATATGATCTTAGGAAGACGTTTCTTTGTTACTCCTAGTGATTCTGTTGCTGTC
TTGGCTGCTAATGCTAGCTCCGTATTTGGTAAGAATGGACATCTTTTAGGTGTTGCCCGT
TCCATGCCTACATCTGGTGCTCTTGATAAGGTAGCTGCCAAGCTTGGAATCAAAAACCTT
TATGAAACTCCCACTGGATGGAAGTTCTTTGGTAACTTGATGGATGCTGGAAAAATTAAT
ATTTGCGGAGAAGAAAGCTTTGGTACTGGTTCTAATCACATTAGAGAAAAGGATGGTATT
TGGGCTATTTTAGCATGGTTGAGCGTTATTGCTGACAGAAACGTAGACAAAACTTAAGAA
GGTCATCTTATCGGAGTTTAATAAATAGTCGAAGAATTCTGGAAGACTTATGGAAGAAAC
TACTATTCTAGATACGATTATGAAGGAGTTGATGCCGATGCTGCCAATAAAGTTATGGCT
CATCTTGAAACCCAATTCAAGCACTTCGAAGAATTATAGAAAGGTAATGTTGCTGATATT
TTCAACTATACTGATCCTGTTGATGGATCTGTTAGCAAGAACTAAGGTATTAGATTTATC
TACGCCGATGGTTCTAGAATCATTTTCAGATTAAGTGGTACTGGTTCTGAAGGAGCTACA
ATTAGAATTTACTTTGAAAAGTATGAAGCTACTGATATTGATCAAAGAACTGATTTAGCC
TTAGAAGAAATAATAAATTTAGGTCTCTAACTTTCTAAGATTTCTGAATTCACTGGAAGA
AATGAACCTACTGTTATCACATGA


>TTHERM_00577080(protein)
MDTHHTIVHKEPITVQVVQTKPFAGQKPGTSGLRKKVSVVKEAHYLENFVSSVFKTIPSE
EFTKENILVVGGDGRYFNKEAIDIIIKIAAAEGVDHIHVAHTGLMSTPAVSAYVRHLNLD
LKLNCIGAFILTASHNPGGPTNDFGIKFNVRNGGPALEDFTNTIYKHTTEITSYKIAHGE
IKYDLHKIQEYVFENVERESKRPKFTIKVVDSTENYINLMKTLFDFDKLKKLFQRKDFQF
RFDGMHGVAGPYAHKIFHEILGAHTDNLINCNPKEDFGGGHPDPNLTYAEHLVKIMDVHN
MINTIAERIPNFGAACDGDADRNMILGRRFFVTPSDSVAVLAANASSVFGKNGHLLGVAR
SMPTSGALDKVAAKLGIKNLYETPTGWKFFGNLMDAGKINICGEESFGTGSNHIREKDGI
WAILAWLSVIADRNVDKTQEGHLIGVQQIVEEFWKTYGRNYYSRYDYEGVDADAANKVMA
HLETQFKHFEELQKGNVADIFNYTDPVDGSVSKNQGIRFIYADGSRIIFRLSGTGSEGAT
IRIYFEKYEATDIDQRTDLALEEIINLGLQLSKISEFTGRNEPTVIT


>TTHERM_00577080(gene)
ATGGATACCCATCATACAATTGTTCATAAGGAACCCATCACTGTTTAAGTTGTTCAAACC
AAGCCTTTTGCTGGTTAGAAACCTGGTACTTCTGGACTTCGTAAAAAGGTAAATTCAAAT
AAGCATAATATATTAACTTAGTCATAGCTATTTCATTTACTCAGCTATTTTATTCATGAC
CCAATTAATTGCATTAAAATAGGTTAGTGTTGTTAAGGAGGCTCATTACTTAGAAAATTT
CGTAAGCTCAGTCTTTAAAACCATTCCCAGCGAAGAATTTACAAGTAAATAATATTTGTT
TTAGCTTAAATATAGATATTCATGCCTATTTATGTATAATTAGAGGAAAACATCTTGGTT
GTTGGTGGTGATGGCAGATATTTCAACAAAGAAGCCATCGATATCATCATTAAAATTGCT
GCTGCAGAAGGTGTTGATCACATTCACGTCGCTCATACTGGTTTAATGTCCACTCCTGCT
GTCTCTGCTTACGTCAGACATTTGAATCTCGACTTGAAGCTTAACTGCATTGGTGCTTTT
ATCTTAACTGCTTCTCACAATCCTGGTGGTCCAACTAACGATTTTGGTATCAAATTCAAT
GTTAGAAATGGTGGTCCAGCTCTTGAAGACTTCACTAACACCATCTACAAGCACACTACT
GAAATAACTTCTTACAAGATTGCTCATGGTGAAATAAAGGTAAAATCTTCATGAAATTCT
TCATTTAATAATTCCCTAATCTCCAAACAAATGATCAGAAATCTTATATAAAATAACCAA
AAATGATAAAAGGTTAAAGTAAATAAAACAGATTATCACATTTAATAAGAAGGCTAATAG
AATATTACAATAAGAACTATTAATATAATTTAAATAAATTATTTTCAAATAAATCAATTA
ATTAACATTTTTTAAATTTTACTAGTATGATTTACACAAGATATAAGAGTACGTTTTCGA
AAATGTAGAAAGAGAATCAAAGAGACCTAAATTCACTATCAAGGTTGTAGACTCAACTGA
AAATTACATTAATTTAATGAAAACCCTCTTCGACTTTGATAAATTGAAGAAACTTTTCTA
AAGAAAGGACTTCTAGTTCCGTTTCGATGGCATGCATGGTGTCGCTGGACCTTATGCTCA
TAAAATCTTCCATGAAATTCTTGGTGCTCACACTGATAATTTGATTAACTGTAACCCTAA
AGAAGACTTTGGTGGTGGTCATCCCGATCCTAACCTCACCTATGCTGAGCATCTTGTTAA
AATTATGGATGTCCACAACATGGTAATAAAATTATTTGAATTTTTAATTAAAAAATTTGA
AAAGCTAGATCAGAAAATAAATAGATATAGTAGTAGAACTAATTTATTAAATTTTAATAT
TAGCTATTTAGTTTGTAAGCAAGCAAGGATAGGATATTAATAATTTTTTAATAGTCCTTT
GATATTTAATTAAAAAAGCTTAAATTTTAAAATAAAAAGCTTAATAAAATAAAAGCAATA
CCCTATTCTAAATAAAAATTTTATTAAAAAAAGATTAATACTATTGCAGAAAGAATTCCC
AATTTTGGTGCTGCATGTGATGGTGATGCTGATAGAAATATGATCTTAGGAAGACGTTTC
TTTGTTACTCCTAGTGATTCTGTTGCTGTCTTGGCTGCTAATGCTAGCTCCGTATTTGGT
AAGAATGGACATCTTTTAGGTGTTGCCCGTTCCATGCCTACATCTGGTGCTCTTGATAAG
GTAGCTGCCAAGCTTGGAATCAAAAACCTTTATGAAACTCCCACTGGATGGAAGTTCTTT
GGTAACTTGATGGATGCTGGAAAAATTAATATTTGCGGAGAAGAAAGCTTTGGTACTGGT
TCTAATCACATTAGAGAAAAGGTATTTAACTTTTTAATATAAATTAATTTTAATCTTCTA
ATTAATTATTTTGATAGGATGGTATTTGGGCTATTTTAGCATGGTTGAGCGTTATTGCTG
ACAGAAACGTAGACAAAACTTAAGAAGGTCATCTTATCGGAGTTTAATAAATAGTCGAAG
AATTCTGGAAGACTTATGGAAGAAACTACTATTCTAGATACGATTATGAAGGAGTTGATG
CCGATGCTGCCAATAAAGTTATGGCTCATCTTGAAACCCAATTCAAGCACTTCGAAGTAA
TAAATAACAATAATTTACTTTGAAATGTTTAAAAATCTAAATGAATTAAAGATTAAATTC
ATTTCGATTAATTAACTATTTTTCACGATAAAAATTGCTTAACTTATCAATTTTAATTTA
TTAATAGGAATTATAGAAAGGTAATGTTGCTGATATTTTCAACTATACTGATCCTGTTGA
TGGATCTGTTAGCAAGAACTAAGGTATTAGATTTATCTACGCCGATGGTTCTAGAATCAT
TTTCAGATTAAGTGGTACTGGTTCTGAAGGAGCTACAATTAGAATTTACTTTGAAAAGTA
TGAAGCTACTGATATTGATCAAAGAACTGATTTAGCCTTAGAAGAAATAATAAATTTAGG
TCTCTAACTTTCTAAGATTTCTGAATTCACTGGAAGAAATGAACCTACTGTTATCACATG
A