Identifiers and Description

Gene Model Identifier

TTHERM_00929450

Standard Name

PGK1 (PhosphoGlycerate Kinase )

Aliases

PreTt17357 | 167.m00106 | PGK | 3752.m00301

Description

Phosphoglycerate kinase; glycolytic enzyme that catalyzes the conversion of 3-phospho-D-glycerate to 3-phospho-D-glyceroyl phosphate

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00929450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19964.19.997093137033517e-262phosphoglycerate kinase (421 a
a)
OxytrichaContig392.1.g739.997093137033517e-262Phosphoglycerate kinase
WormBaseWBGene000201851.999658401959794e-176locus:pgk-1 Probable phospho
glycerate kinase status:Conf
irmed UniProt:P91427 prote
in_id:CCD67788.1
SGDYCR012W4.0000050475224054e-168PGK1 3-phosphoglycerate kinase
, catalyzes transfer of high-e
nergy phosphoryl groups from t
he acyl phosphate of 1,3-bisph
osphoglycerate to ADP to produ
ce ATP; key enzyme in glycolys
is and gluconeogenesis
DictyBaseDDB_G02875952.0009356157506544e-160pgkA on chromosome: 5 position
494968 to 496392
Stentor CoeruleusSteCoe_126392.001470128041443e-75

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:8052610: Golding GB, Tsao N, Pearlman RE (1994) Evidence for intron capture: an unusual path for the evolution of proteins. Proceedings of the National Academy of Sciences of the United States of America 91(16):7506-9
  2. Ref:7922679: Golding B (1994) Exploratory analysis of multiple sequence alignments using phylogenies. Computer applications in the biosciences : CABIOS 10(3):243-7
  3. Ref:1602492: Vohra GB, Golding GB, Tsao N, Pearlman RE (1992) A phylogenetic analysis based on the gene encoding phosphoglycerate kinase. Journal of molecular evolution 34(5):383-95

Sequences

>TTHERM_00929450(coding)
ATGTTGTCTCGTAAGATTGGTATTGATCACATCTTGAAACATATTGAAAACAAGAGAGTT
TTAATGAGAGTAGACTTCAACGTTCCTTTGAAGGAAGGTAAGGTTAAAGATCCTACTCGT
ATCTAAGGTTCTGTTCCTTCTATCAAGAAAATCTTAGAGTAAAATCCTAAAGGTCTTGTC
TTGATGAGTCACTTGGGTCGTCCTGATGGCAACAGAGTTGAAAAGCACTCAATGAAGCCT
GTTGTTCCTAAGCTTGAAGAATTACTCGGCACCAAGGTAACCTTCTTGAATGACTGTGTT
GGTAAGGATGTAGAAGAAGCTGTTAAATCAAGCAGAAACGGTGAAATCATTTTACTTGAA
AACTTGCGTTTCCATCCTGAAGAAGAAGGAAAGTACATCGATGCTGCAGGAAACAAGGTT
AAGGCTGACTCTAAGGCAGTTAAGGAATTCAGAAAATCTTTGACTAGTTTGGGTGACTTA
TTCGTCAACGATGCTTTCGGTACCGCTCACAGAGCTCACTCTTCCATGGTCGGTGTTGAT
CACAAAATCAGAGCTGCTGGTTACCTCTTGAAGAGAGAATTAGACTACTTCAGTAAGGCT
TTGGAATCCCCTAACAGACCTTTCTTAGTTGTCTTAGGTGGTGCTAAGGTCAAGGATAAA
ATCTAATTGATTGAAAGTATGCTTGACAAGGTCGATGAAATGATCATTGGTGGTGGTATG
GCCTTCACTTTCTTGAAGAAAATCCACAATATTGAAATTGGTAACTCCCTCTTCGACGAA
GAAGGTTATAAGATTGTTGACCAATTGTTAGAAAAGGCTAAAGCTAAGAATGTCAAGATC
CATTTACCAGTTGATTTCTTGTGCGGTGACTCACTTGAAGCCAACGCTAACACCCGTAGC
TTTGACTTAAAGAGTGGTATCCCTGCTGGATGGATTGGTTTAGATGCTGGTCCTAAGACT
ATGGCTGAAAACGCTGAAGCTGTTGCCCGTGCTAACACTATTGTCTGGAATGGTCCTTAA
GGTAGATTCGAAGTTGATAAGTTTAAAGTAGGATCTTCTGACCTTCTCAAGCACGTTGCT
ACTAGAACTTCCTAAGGAGCTACTTCTATTATTGGTGGTGGTGACACTGTCAATCTTGTT
CAACAAGAAAAGGCAACTCAAAAAGTCAGCCACGTCTCTACTGGTGGTGGTGCATCTCTT
GAACTTCTTGAAGGTAAAGTCCTTCCTGGTGTTGCTTATCTTACTGATATTGACTAACTT
TGA


>TTHERM_00929450(protein)
MLSRKIGIDHILKHIENKRVLMRVDFNVPLKEGKVKDPTRIQGSVPSIKKILEQNPKGLV
LMSHLGRPDGNRVEKHSMKPVVPKLEELLGTKVTFLNDCVGKDVEEAVKSSRNGEIILLE
NLRFHPEEEGKYIDAAGNKVKADSKAVKEFRKSLTSLGDLFVNDAFGTAHRAHSSMVGVD
HKIRAAGYLLKRELDYFSKALESPNRPFLVVLGGAKVKDKIQLIESMLDKVDEMIIGGGM
AFTFLKKIHNIEIGNSLFDEEGYKIVDQLLEKAKAKNVKIHLPVDFLCGDSLEANANTRS
FDLKSGIPAGWIGLDAGPKTMAENAEAVARANTIVWNGPQGRFEVDKFKVGSSDLLKHVA
TRTSQGATSIIGGGDTVNLVQQEKATQKVSHVSTGGGASLELLEGKVLPGVAYLTDIDQL


>TTHERM_00929450(gene)
ATGTTGTCTCGTAAGATTGGTATTGATCACATCTTGAAACATATTGAAAACAAGAGAGTT
TTAATGAGAGTAGACTTCAACGTTCCTTTGAAGGAAGGTAAGGTTAAAGATCCTACTCGT
ATCTAAGGTTCTGTTCCTTCTATCAAGAAAATCTTAGAGTAAAATCCTAAAGGTCTTGTC
TTGATGAGTCACTTGGGTCGTCCTGATGGCAACAGAGTTGAAAAGCACTCAATGAAGCCT
GTTGTTCCTAAGCTTGAAGAATTACTCGGCACCAAGGTATTTTATTTGGCATACTACATT
CTGATTTTTTTATCGTTATTTTTTCAAAAACTTATAGGTAACCTTCTTGAATGACTGTGT
TGGTAAGGATGTAGAAGAAGCTGTTAAATCAAGCAGAAACGGTGAAATCATTTTACTTGA
AAACTTGCGTTTCCATCCTGAAGAAGAAGGAAAGTACATCGATGCTGCAGGAAACAAGGT
ATTTTTTAATAACTTTATTTAGTTGACTAAGATCAAACCAAGTTTCTTTTCACTTATGGG
CCATATTTTATTAAGCCTATGAAAATCAATAGTTTGATTGAGAGTTTTGAATTTTTAAAA
ATTATGGTCCTAAACAACACCATTCTTTAACGGAGCTGAGTTATTTTAAAAGTTTAGCCA
CCAAGCATTAAGTTGGTGTGCTTTTCAAAAAATTTCTATAATATACCAAGAAGTATTCTT
CAAATTCAATTACTATTTTTTTTGCCATTTTTAAAGGTTAGTTTTTGATTTTTTAAAAAA
AAAAGATCATAAATTAATCAATAAATAAATAACAAGAAGGTAGAAATAAAATAAATTAAG
TACAACCTAAAATATGTAAATGAGCATATTTAAAATAGAATAAATTATCAGCAGAGTTAA
AAAAAATATAAAAAATTTCCATCACTAAGCAACCATAAGAAACATATTAAACCAAAATAA
GTATGAACAAAAAGCTATTATCATAGTTGTCTCTTAAAAAAATGAAAAGCAAAATAAGTT
CATAAAGCAATAATTAATTTTAATTGAAAATGAAATACATTCAAAAGTTTGAAAAATGTT
TGATTATTTTTTAAAGTATAAAGACAGTCATAAATTATAATCTAAACACTTTTGTTTTGT
TTAATATAGGTTAAGGCTGACTCTAAGGCAGTTAAGGAATTCAGAAAATCTTTGACTAGT
TTGGGTGACTTATTCGTCAACGATGCTTTCGGTACCGCTCACAGAGCTCACTCTTCCATG
GTCGGTGTTGATCACAAAATCAGAGCTGCTGGTTACCTCTTGAAGAGAGAATTAGACTAC
TTCAGTAAGGCTTTGGAATCCCCTAACAGACCTTTCTTAGTTGTCTTAGGTGGTGCTAAG
GTCAAGGATAAAATCTAATTGATTGAAAGTATGCTTGACAAGGTCGATGAAATGATCATT
GGTGGTGGTATGGCCTTCACTTTCTTGAAGAAAATCCACAATATTGAAATTGGTAACTCC
CTCTTCGACGAAGAAGGTTATAAGATTGTTGACCAATTGTTAGAAAAGGCTAAAGCTAAG
AATGTCAAGATCCATTTACCAGTTGATTTCTTGTGCGGTGACTCACTTGAAGCCAACGCT
AACACCCGTAGCTTTGACTTAAAGAGTGGTATCCCTGCTGGATGGATTGGTTTAGATGCT
GGTCCTAAGACTATGGCTGAAAACGCTGAAGCTGTTGCCCGTGCTAACACTATTGTCTGG
AATGGTCCTTAAGGTAGATTCGAAGTTGATAAGTTTAAAGTAGGATCTTCTGACCTTCTC
AAGCACGTTGCTACTAGAACTTCCTAAGGAGCTACTTCTATTATTGGTGGTGGTGACACT
GTCAATCTTGTTCAACAAGAAAAGGCAACTCAAAAAGTCAGCCACGTCTCTACTGGTGGT
GGTGCATCTCTTGAACTTCTTGAAGGTAAAGTCCTTCCTGGTGTTGCTTATCTTACTGAT
ATTGACTAACTTTGA