Identifiers and Description

Gene Model Identifier

TTHERM_01108680

Standard Name

PGI2 (PhosphoGlucoIsomerase)

Aliases

PreTt20399 | 238.m00049 | 3797.m00208

Description

Glycolytic enzyme phosphoglucose isomerase, catalyzes the interconversion of glucose-6-phosphate and fructose-6-phosphate.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01108680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18875.12.9998215087698487e-30glucose-6-phosphate isomerase
(565 aa)
OxytrichaContig18210.0.g670.000000000003001226732525078Phosphoglucose isomerase
DictyBaseDDB_G02836730.000000000029994712494008525gpi on chromosome: 4 position
954966 to 956651
SGDYBR196C0.000000000800327577657144PGI1 Glycolytic enzyme phospho
glucose isomerase, catalyzes t
he interconversion of glucose-
6-phosphate and fructose-6-pho
sphate; required for cell cycl
e progression and completion o
f the gluconeogenic events of
sporulation
WormBaseWBGene000135970.0000000010002658722841845locus:gpi-1 Glucose-6-phosph
ate isomerase status:Confirm
ed UniProt:Q7K707 protein_
id:CAE54920.1
Stentor CoeruleusSteCoe_13020.00000614421235332821

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01108680(coding)
ATGGTTTAATTTTTAAATATAGGTTTTGTTTGCAAGAATGAAGATAAAATTAAGGATTTA
GTCAATCACCACATGTGTGCTGCTTCTACTAATTTAACTGATACCTCCAAGTTTGGTATC
TCAGCTGAAAAAGTTTTTGGCTTCTGGGATTGGGTCAGTGGAAGATACTAAGTCTGGAGT
GCAGTAGGCTAAACATTAATTTAAAAATATGTGCTCACAATATTGATACCCATTTAGCAA
AAACAACTTCAATTAAAGGAAATTTACCTTTGTTATTAGCTTTGGTTGGATTCTACAATA
CCTCAATTAAGAATTTAAATGCCAGAGCTATTCTTCCTTACTGCTAAGCTCTCTTTAAAT
TTGTTCCTCATGCACAATAATTAGACATGGAATCGAATGGTAAGAGAGTAAATCTTGCTG
GACAAACCCTTGATTATGAATGTACAGTCGTTAATTTTGGTGAACCTGGTACTAATGGTT
AACATAGTTTCTATTAGCTTTTACATTAAGGTAGAATTGTTCCTTGCGAATTTATTGGAT
TCTGCAGATCCTAGTGCCCTTTTGTTTTAGCTGGAGAACCAAAGTAACCACCTGATGCCT
TAGCTTGTGGTAAAACTATTGAAGAACTTAAGGCTGAAAAAGTTCCTGAGAATTTACAAA
ATCACAAATATTTCCCTGGAGATAGACCCTCCTTATCCTTATTATTTACTGAATTAAATC
CTTACACTGCTGGTTAATTACTTGCTCTTTACGAACATAGAATTGCTATTGAAGGTTTCT
TGTGGGATATTAATAGCTTTGATTAGTGAGGTGTAGAACTCGGTAAAGTACTTGCTAAGT
AGGTAAGAACCTTCTTCTAAAACCACAAAGACAAGAACACTGCCAATTTCACTGGTACAA
AATTTAACTCTGCTACTGAAGCTTTATTATCTAAGTTTGTCTAACATAAATGAAAATCAA
TAACAATGCAAAATATATTTATTTATTTTTATCTTTATTTGCATAAAATTGTTTTAGAAA
ATATTAATTGAATTGTTTAATAATTCCTACATAATTTGA


>TTHERM_01108680(protein)
MVQFLNIGFVCKNEDKIKDLVNHHMCAASTNLTDTSKFGISAEKVFGFWDWVSGRYQVWS
AVGQTLIQKYVLTILIPIQQKQLQLKEIYLCYQLWLDSTIPQLRIQMPELFFLTAKLSLN
LFLMHNNQTWNRMVREQILLDKPLIMNVQSLILVNLVLMVNIVSISFYIKVELFLANLLD
SADPSALLFQLENQSNHLMPQLVVKLLKNLRLKKFLRIYKITNISLEIDPPYPYYLLNQI
LTLLVNYLLFTNIELLLKVSCGILIALISEVQNSVKYLLSRQEPSSKTTKTRTLPISLVQ
NLTLLLKLYYLSLSNINENQQQCKIYLFIFIFICIKLFQKILIELFNNSYII


>TTHERM_01108680(gene)
ATGGTTTAATTTTTAAATATAGGTTTTGTTTGCAAGAATGAAGATAAAATTAAGGATTTA
GTCAATCACCACATGTGTGCTGCTTCTACTAATTTAACTGATACCTCCAAGTTTGGTATC
TCAGCTGAAAAAGTTTTTGGCTTCTGGGATTGGGTCAGTGGAAGATACTAAGTCTGGAGT
GCAGTAGGTATTCCCCCATTGTCTATTCAATTTGGCAACGATTATATGGATAGATTCTAA
AAAGGATTGCTTATAATTAAATTTTATATAAATTTAGGCTAAACATTAATTTAAAAATAT
GTGCTCACAATATTGATACCCATTTAGCAAAAACAACTTCAATTAAAGGAAATTTACCTT
TGTTATTAGCTTTGGTTGGATTCTACAATACCTCAATTAAGAATTTAAATGCCAGAGCTA
TTCTTCCTTACTGCTAAGCTCTCTTTAAATTTGTTCCTCATGCACAATAATTAGACATGG
AATCGAATGGTAAGAGAGTAAATCTTGCTGGACAAACCCTTGATTATGAATGTACAGTCG
TTAATTTTGGTGAACCTGGTACTAATGGTAATCAACATTATTAATTTAAAAGCACATATT
ATTATATACTTAACCTTAATAGTTAATGTAATAGTTTTTAAAAAAATAATAATAAATTAA
ATAACATATAGGTTAACATAGTTTCTATTAGCTTTTACATTAAGGTAGAATTGTTCCTTG
CGAATTTATTGGATTCTGCAGATCCTAGTGCCCTTTTGTTTTAGCTGGAGAACCAAAGTA
ACCAGTCATGAAGAATTGATGTCTAATTCCTTCTCATAAGTACTCATTTATTTACTAATT
AATATTTTTTATACAAATTATACTATTTATTTATAATAGCCTGATGCCTTAGCTTGTGGT
AAAACTATTGAAGAACTTAAGGCTGAAAAAGTTCCTGAGAATTTACAAAATCACAAATAT
TTCCCTGGAGATAGACCCTCCTTATCCTTATTATTTACTGAATTAAATCCTTACACTGCT
GGTTAATTACTTGCTCTTTACGAACATAGAATTGCTATTGAAGGTAAAAAATTATTTACA
TTTAAAACTTAATTTTTAATTTGCTATACAAAAATTTCTAGGTTTCTTGTGGGATATTAA
TAGCTTTGATTAGTGAGGTGTAGAACTCGGTAAAGTACTTGCTAAGTAGGTAAGAACCTT
CTTCTAAAACCACAAAGACAAGAACACTGCCAATTTCACTGGTACAAAATTTAACTCTGC
TACTGAAGCTTTATTATCTAAGTTTGTCTAACATAAATGAAAATCAATAACAATGCAAAA
TATATTTATTTATTTTTATCTTTATTTGCATAAAATTGTTTTAGAAAATATTAATTGAAT
TGTTTAATAATTCCTACATAATTTGA