Identifiers and Description

Gene Model Identifier

TTHERM_00338470

Standard Name

PFK3 (PhosphoFructoKinase)

Aliases

PreTt06087 | 34.m00324 | 3689.m00120

Description

Alpha subunit of heterooctameric phosphofructokinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00365 ) Phosphofructokinase
  • ( TIGR02483 ) phosphofructokinase
  • ( TIGR02478 ) 6-phosphofructokinase
  • ( TIGR02482 ) 6-phosphofructokinase
  • ( PF02078 ) Synapsin, N-terminal domain
  • ( TIGR01274 ) 1-aminocyclopropane-1-carboxylate deaminase
  • ( TIGR00689 ) sugar-phosphate isomerases, RpiB/LacA/LacB family
  • ( TIGR02477 ) diphosphate--fructose-6-phosphate 1-phosphotransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00338470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15103.19.997093137033517e-262phosphofructokinase (561 aa)
OxytrichaContig14330.0.g572.000724368835138e-100Phosphofructokinase
Stentor CoeruleusSteCoe_66677.47197233734299e-43
DictyBaseDDB_G02741110.0000000000005000841553255702pfkA on chromosome: 2 position
4510635 to 4513139
SGDYGR240C0.0000000020002373268528243PFK1 Alpha subunit of heterooc
tameric phosphofructokinase in
volved in glycolysis, indispen
sable for anaerobic growth, ac
tivated by fructose-2,6-bispho
sphate and AMP, mutation inhib
its glucose induction of cell
cycle-related genes
WormBaseWBGene000082300.000000030002053728821195locus:pfk-2 Probable 6-phosp
hofructokinase status:Partia
lly_confirmed UniProt:Q27483
protein_id:CAA94737.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00338470(coding)
ATGAGTAATAGATAAGAGTAAAAAATTAGTTCAATCATTCAATTAATAACAATACTTATT
AGTATAAGAAGACGAATAATTAATTAATAAATTAATTAACATGAATTATTTCTAAATAAA
AGTGTGATCGGACTTCTATTATTAACTAAATCTTTAATTAGATACATACATACTGCTTTT
AATAAAATAAACTTAGAAAAAAAAGCAATCAAAAACAAAAATAAATTAAAATCTACTTTC
AAATCAAGCAAGCATAAATGGGATTTTATTTAACCTTATTTTATAGATTTAAAGCAAGGT
ATTGTTCTAACTGGTAGCATATCATTTGGTGTTATTGGTAGTATAGTAGCAAATTTGGTT
TACAAAAATATTGAAAAGAAGAAAAAGAAAGATCAAGTTGAATATGATGGTTTCTTAGCA
GAATAAGAAGATGTGATTGAAGAAGAAATAGACTTCAAATACAGAGTTTCATCAAGAAAA
AAAACTGCTACAATTCATACTGACCCTGAAAATCTTAATATTGACAGGTAAAGACTCAAA
GTAAGTGCTAAGATTCACATTGATAATCATTTAATTGAAGAACTTAGATTCCTTGATTCT
CCTATATGTGAAATAGAAAGAGTCCATAATCTTATTATTGATAGAGGTTTGACTTAGATT
GATGATATAGTAACTAAAAAAGCAGAATCTATGCCTAAAGGAGCATTTATTTTCACAAAT
ACCTTTATCCTTAATAAGGTTGAATACGGCCCAACTTGCATGATTTAGTCAGCTAAAAGA
TGGCTCAGAGCTGGTCCTAGATATCATTTATATTTTTAACCTTAGGAAGTAAAAGCATTA
GTCCTTTCAGTAGGTAGTATAGTTCCAGGAATCAATGTAGTTATTAGGGAAATAGTGCGT
GCTCTTAATAATAATTATGGGGCAAATTAGGTTTTTGGTGCAAGATTTGGCTATAAAGGA
GTGATTGAGGAAAACTTCATAGATTTGAGTAAAAACTTAGCTGAAAATGTTCATTCCACT
GGAGGATCCTTTTTAGGAGTCTGTAGAGGTGGATTCAATTTGCATTTAATTCTAAAAGTT
TTGATTAAGCATGGATTTAACTAATTGTATATCATCGGTGGAGATGGAGCTATGAGAAGT
GCATAAGCACTTTTAATTGAAATATCTAAAAAAAAGCATAATATTGCTATATGTGTAATT
CCTAAAAGTGTCTAAGGTGATATCCCTATTGCTGAAGAATAAATGGGTTTTTAAACAACC
ATTGAAGAAACTGCAAAGGCTGTTGAAGCAGGATTTGTGGAAAGCTAATCTCATGAATAC
GGTATTGGTCTAATCAGATGCTTTGGTAGAAATGCTGGGTTTGTTGCAAGTCATGTTGCT
GAAGCCACTGGTTGTGTTGATGTTGTACTTGTGCCTGAGTTTTAATGGGATCTCTATGGA
GAAAAGGGTGTTTTGGAATACATTAGAAGCCAAATTAAAATTAAAAAGCATCTTATCATT
ATTGTTAGTGAGGGTTCAGTTAATAGCTTAAGAGATGTCCACTTACCTGAATTAGGAGAA
GATGAATCAGGAAATAAAATTTACATAAATATTGGTGAATTCTTAAAAGATAAAATCATC
CAATATTGTGAGGATAAAAAGTAACCAATAATCATCAAATTTATTGACCCTCTCTACATA
ACTAGGGCATGTAGAGCTAATCCACATGACACCAAGGTTTGCAGCTAAATGGCTTAAAAT
GCAGTTCATGGATGTATGGCAGGATTTACTGGATTTGCTGTAGTCATTGTGCATCATAAA
ACAGCTTTCGTTCCATTATCAGAAATGGTATCAGGAAATTATGAAAATAAATTGGTCCCT
CATAACAGACATTGGTAGAGAGTTTTATCATAAACCTTATAACCTTCTTTCATAAATAAT
GAAGAAGAGCACCTTAAATAATAAGAATAAGAGAACAAAGCTTTGTGA


>TTHERM_00338470(protein)
MSNRQEQKISSIIQLITILISIRRRIINQQINQHELFLNKSVIGLLLLTKSLIRYIHTAF
NKINLEKKAIKNKNKLKSTFKSSKHKWDFIQPYFIDLKQGIVLTGSISFGVIGSIVANLV
YKNIEKKKKKDQVEYDGFLAEQEDVIEEEIDFKYRVSSRKKTATIHTDPENLNIDRQRLK
VSAKIHIDNHLIEELRFLDSPICEIERVHNLIIDRGLTQIDDIVTKKAESMPKGAFIFTN
TFILNKVEYGPTCMIQSAKRWLRAGPRYHLYFQPQEVKALVLSVGSIVPGINVVIREIVR
ALNNNYGANQVFGARFGYKGVIEENFIDLSKNLAENVHSTGGSFLGVCRGGFNLHLILKV
LIKHGFNQLYIIGGDGAMRSAQALLIEISKKKHNIAICVIPKSVQGDIPIAEEQMGFQTT
IEETAKAVEAGFVESQSHEYGIGLIRCFGRNAGFVASHVAEATGCVDVVLVPEFQWDLYG
EKGVLEYIRSQIKIKKHLIIIVSEGSVNSLRDVHLPELGEDESGNKIYINIGEFLKDKII
QYCEDKKQPIIIKFIDPLYITRACRANPHDTKVCSQMAQNAVHGCMAGFTGFAVVIVHHK
TAFVPLSEMVSGNYENKLVPHNRHWQRVLSQTLQPSFINNEEEHLKQQEQENKAL


>TTHERM_00338470(gene)
ATGAGTAATAGATAAGAGTAAAAAATTAGTTCAATCATTCAATTAATAACAATACTTATT
AGTATAAGAAGACGAATAATTAATTAATAAATTAATTAACATGAATTATTTCTAAATAAA
AGTGTGATCGGACTTCTATTATTAACTAAATCTTTAATTAGATACATACATACTGCTTTT
AATAAAATAAACTTAGAAAAAAAAGCAATCAAAAACAAAAATAAATTAAAATCTACTTTC
AAATCAAGCAAGCATAAATGGGTATTTAAATTATTATTTATTTTTGAATACTGATCAATA
GCTTTTATAGCCAAAATAACCATTTATCTAGATTATCTTAGGATTTTATTTAACCTTATT
TTATAGATTTAAAGCAAGGTATTGTTCTAACTGGTAGCATATCATTTGGTGTTATTGGTA
GTATAGTAGCAAATTTGGTTTACAAAAATATTGAAAAGAAGAAAAAGAAAGATCAAGTTG
AATATGATGGTTTCTTAGCAGAATAAGAAGATGTGATTGAAGAAGAAATAGACTTCAAAT
ACAGAGTTTCATCAAGAAAAAAAACTGCTACAATTCATACTGACCCTGAAAATCTTAATA
GTAAATTAAAATAAATTTTCAATTCTATTTTAGTTTTATAATTTGAATGCTAGTAAGCTG
AAAGCATAATATACAAAACAAACTAAATATACTGCAAAATCACTTTAGAACTAAAGAAAA
TAAAATAATATTTTGAACTGAAATATTTTTAAAAGAAAGCATGTGCATTTTTTTTATAAG
CGTTAAATAAAATTTCTTACAGCTTATATTTTTAAATAGCTTTTTTGTAATTCTAAAAAA
TAATAAATATAAAAATCGTTTTTAATTAATTAATGATTTAGTTTATTTGTTAATTTATTT
ATTTATTAAACAAATTTAATTAATTAGCTTTATATTTAAAATAAATATTATAAAGTTGAC
AGGTAAAGACTCAAAGTAAGTGCTAAGATTCACATTGATAATCATTTAATTGAAGAACTT
AGATTCCTTGATTCTCCTATATGTGAAATAGAAAGAGTCCATAATCTTATTATTGATAGA
GTATGATAAAAATGAATGAATAGGTTTAATTTGGTAACTTATTTTATTAATATAAAAAGG
GTTTGACTTAGATTGATGATATAGTAACTAAAAAAGCAGAATCTATGCCTAAAGGAGCAT
TTATTTTCACAAATACCTTTATCCTTAGTAAATATATTTGAAATAGAAAGTATTTTACTA
TAATTAAGTTAAAAATTAATAAAAAAATAAAAGATAAGGTTGAATACGGCCCAACTTGCA
TGATTTAGTCAGCTAAAAGATGGCTCAGAGCTGGTCCTAGATATCATTTATATTTTTAAC
CTTAGGAAGTAAAAGCATTAGTCCTTTCAGTAGGTAGTATAGTTCCAGGAATCAATGTAG
TTATTAGGGAAATAGTGCGTGCTCTTAATAATAATTATGGGGCAAATTAGGTTTTTGGTG
CAAGATTTGGCTATAAAGGAGTGATTGAGGAAAACTTCATAGATTTGAGTAAAAACTTAG
CTGAAAATGTTCATTCCACTGGAGGATCCTTTTTAGGAGTCTGTAGAGGTGGATTCAATT
TGCATTTAATTCTAAAAGTTTTGATTAAGCATGGATTTAACTAATTGTATATCATCGGTG
GAGATGGAGCTATGAGAAGTGCATAAGCACTTTTAATTGAAATATCTAAAAAAAAGCATA
ATATTGCTATATGTGTAATTCCTAAAAGTGTCTAAGGTGATATCCCTATTGCTGAAGAAT
AAATGGGTTTTTAAACAACCATTGAAGTAAAACATTTAAAGTATAATTAAATATTCTAAA
AAATTTATTTTCATTTTTAGGAAACTGCAAAGGCTGTTGAAGCAGGATTTGTGGAAAGCT
AATCTCATGAATACGGTATTGGTCTAATCAGATGCTTTGGTAGAAATGCTGGGTTTGTTG
CAAGTCATGTTGCTGAAGCCACTGGTTGTGTTGATGTTGTACTTGTGCCTGAGTTTTAAT
GGGATCTCTATGGAGAAAAGGGTGTTTTGGAATACATTAGAAGCCAAATTAAAATTAAAA
AGCATCTTATCATTATTGTTAGTGAGGGTTCAGGTAAAAATTATATTTCATTGTGTTGTA
AAAATAAAATTATTGGTTACTGATAAATTAGTTAATAGCTTAAGAGATGTCCACTTACCT
GAATTAGGAGAAGATGAATCAGGAAATAAAATTTACATAAATATTGGTGAATTCTTAAAA
GATAAAATCATCCAATATTGTGAGGATAAAAAGTAACCAATAATCATCAAATTTATTGAC
CCTCTCTACATAACTAGGGCATGTAGAGCTAATCCACATGACACCAAGGTTTGCAGGTAT
AAAAATTTTTTGAGAATTGATTTTTTTTAAAAGAATTAAATAAATTAATAGCTAAATGGC
TTAAAATGCAGTTCATGGATGTATGGCAGGATTTACTGGATTTGCTGTAGTCATTGTGCA
TCATAAAGTAAATAAAATTTATAAAATAAATCATATTTAATGATAAAATTTAAATTTTTT
AATAGACAGCTTTCGTTCCATTATCAGAAATGGTATCAGGAAATTATGAAAATAAATTGG
TCCCTCATAACAGACATTGGTAGAGAGTTTTATCATAAACCTTATAACCTTCTTTCATAA
ATAATGAAGAAGAGCACCTTAAATAATAAGAATAAGAGAACAAAGCTTTGTGA