Identifiers and Description

Gene Model Identifier

TTHERM_00338460

Standard Name

PFK2 (PhosphoFructoKinase)

Aliases

PreTt06086 | 34.m00323 | 3689.m00119

Description

Beta subunit of heterooctameric Phosphofructokinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.8%

TetraMine Data

TTHERM_00338460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15104.19.997093137033517e-262phosphofructokinase (542 aa)
OxytrichaContig14330.0.g571.999447289884935e-116Phosphofructokinase
Stentor CoeruleusSteCoe_66671.6889118802245324e-48
DictyBaseDDB_G02741110.0000000000010000211161514907pfkA on chromosome: 2 position
4510635 to 4513139
WormBaseWBGene000082300.000000000040005666873964816locus:pfk-2 Probable 6-phosp
hofructokinase status:Partia
lly_confirmed UniProt:Q27483
protein_id:CAA94737.1
SGDYGR240C0.0000000020002373268528243PFK1 Alpha subunit of heterooc
tameric phosphofructokinase in
volved in glycolysis, indispen
sable for anaerobic growth, ac
tivated by fructose-2,6-bispho
sphate and AMP, mutation inhib
its glucose induction of cell
cycle-related genes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00338460(coding)
ATGGAAAAAAACACTGTTTTGACTACAAGCATTGGTGTTTCAGTTGGTGTATTAACATCT
CTTCTCATCAATTATCTCAGAAATTAAAAAGCTGAGTGCAAACAATAAAGACAATCTTTG
GCTATTACAGAATCCGAATAACCATATGAAGATGATGATGCTAAGAGAAGAAAAGTTATC
TAAGAGCTCATTAAAACTAACAAAGGCAAGTACAAAGAATTCCATAGACTTAAAATTAAG
GATGGTGCATTAGTTGGAAATTCATTACTTGATGAAATCAGATTCCTTGACAGTGCTCTT
TGTGAAATAGAGAAAGTTCCTAACCTCATTATTGATTTAGGATTAGACATCTTTGAAGAG
GTAGTTAACCCTATTGCAAGACACACTCATAAAGATACTTTTATTAATACAAACTCATTT
ATTTTATCCTATGCTGCATTTGGTCCTTCTTAAATGATTCAAAATGCTAAGAGATGGTTA
AGAGCTGGTCCTCGTTATCACAATTACTTTAGACCTGACTAATCAAAGGTTTTGATTGTG
ACATAAGATGGCCTTTGCCCTGGTTTGAATGTCGTCATTAGAGAAATTGTTATGCACTTA
AATTACAACTATTAGGTTGAATAAATCTATGGAGCCAAATTTGGTTGGAAAGGTATTTAC
GAGGAAGACTGGGTTCAATTAATTCCCAGCTAAATTAAAACTATCCATCACAGAGGTGGT
ACCTTCATAGGAACTTCAAGAACTGGTTTTGATAGAGATAAAATTATTGAAACACTTATC
AAGCACAATTTTAATTAGCTCTATGTCATCTGCGGAAACAAATCCATGGGTCAAGTTCTT
GAACTTTATTATGAAATCAGAAGAAGAAAACTCAATATTGGTGTTTGTAACATTCCAAGA
AGCGTCGATAATGATATTCCTATTATCGATGAATCATTTGGTTATTAATCTTGTGTTGAA
GAAGCTTAAAGAGTAATTGATAGTGCTTGGGTCGAATCTCGTTCCCATAGAAATGGTGTT
GGTATTATTAGAGTTATGGGATAAAAGAGTGGATTTATTGCTATGGGTGCTTGTCTTGCA
TCTCGTTGTGTAAATGTATGTTTGATCCCTGAATTTAATTACGATCTATATGGAAAGAGT
GGTGTCCTTGACTATATCAAATAGAGAATTATTAAGAAGGGTCATTGTATAGTTGTTGTT
TCTGAAGGAGCCAACAGCTCATTTGCTGATGCTGATGATGTTCCTGGTGATGTTGGTAAA
TTCTTATAAGATGAAATTCAAAAGTTTTGTGCTTAAGACAATACTGAAGTTACTGTAAAA
TATTTTGATCCTTTATATATGCTTCGTGCTGTTAGAGCTAATGCTTATGACACCAAATAG
TGCAGTACTCTTGCTTAAAACGCAGTACATGGTTTAATGGCAGGTTTCACTGGGTTTTCT
ATTGGTCACGTCCATAACAAGACTTGTTTCATACCTCTTGAAGAAATGCTTAGTGGAAAT
TATAGAAATAGAATAGTAGCAAGTAACAAAAACTGGTAGAGATTACTAGCTTCTACTGGT
TAGCCATCCTTCATCAATGAAGAAGAATTAAAGAAAATAATTGGAACTAGCAAATAAGAA
TGA


>TTHERM_00338460(protein)
MEKNTVLTTSIGVSVGVLTSLLINYLRNQKAECKQQRQSLAITESEQPYEDDDAKRRKVI
QELIKTNKGKYKEFHRLKIKDGALVGNSLLDEIRFLDSALCEIEKVPNLIIDLGLDIFEE
VVNPIARHTHKDTFINTNSFILSYAAFGPSQMIQNAKRWLRAGPRYHNYFRPDQSKVLIV
TQDGLCPGLNVVIREIVMHLNYNYQVEQIYGAKFGWKGIYEEDWVQLIPSQIKTIHHRGG
TFIGTSRTGFDRDKIIETLIKHNFNQLYVICGNKSMGQVLELYYEIRRRKLNIGVCNIPR
SVDNDIPIIDESFGYQSCVEEAQRVIDSAWVESRSHRNGVGIIRVMGQKSGFIAMGACLA
SRCVNVCLIPEFNYDLYGKSGVLDYIKQRIIKKGHCIVVVSEGANSSFADADDVPGDVGK
FLQDEIQKFCAQDNTEVTVKYFDPLYMLRAVRANAYDTKQCSTLAQNAVHGLMAGFTGFS
IGHVHNKTCFIPLEEMLSGNYRNRIVASNKNWQRLLASTGQPSFINEEELKKIIGTSKQE


>TTHERM_00338460(gene)
ATGGGTATATCATATTTATTATATTATAGCATGCTCCTCATGAGTATGGATTAGTGAAAA
TAATATTTTTTTATAAAATAAATATGTATTGCAGAAAAAAACACTGTTTTGACTACAAGC
ATTGGTGTTTCAGTTGGTGTATTAACATCTCTTCTCATCAATTATCTCAGAAATTAAAAA
GCTGAGTGCAAACAATAAAGACAATCTTTGGCTATTACAGAATCCGAATAACCATATGAA
GATGATGATGCTAAGAGAAGAAAAGTTATCTAAGAGCTCATTAAAACTAACAAAGGCAAG
TACAAAGGTAGAAAATTGCTTTAAAATTTAATTTACATATTTGACTCAAAAGCATATAGA
ACTATACAGCAAAAACAAAACATGCAAAAAATCTAAAAAAAAAGTTATATAGATTTAAAA
ACAAGCTTTAATTTGATTCAAAGAATAAAAAATATTTTAAATATACCATAAAGAATATTC
ATTCATAATTATTCGATTAACAAATAACGCCATAAAATTGTCTTCAACAATAAACTTAGT
AGTTTTTCAATTTAAAAATACTATAAATAGAATTCCATAGACTTAAAATTAAGGATGGTG
CATTAGTTGGAAATTCATTACTTGATGAAATCAGATTCCTTGACAGTGCTCTTTGTGAAA
TAGAGAAAGTTCCTAACCTCATTATTGATTTAGTAAGCAATCAAACGTTTACACCTAAAA
CTTTAAATTGAATTTAAAATATTTAAAATCAAAAGGGATTAGACATCTTTGAAGAGGTAG
TTAACCCTATTGCAAGACACACTCATAAAGATACTTTTATTAATACAAACTCATTTATTT
TATGTAAGTGATTAATCTTTTGTTTAAATTTTAATTTTTATTAATGAATCTGAAAAGCCT
ATGCTGCATTTGGTCCTTCTTAAATGATTCAAAATGCTAAGAGATGGTTAAGAGCTGGTC
CTCGTTATCACAATTACTTTAGACCTGACTAATCAAAGGTTTTGATTGTGACATAAGATG
GCCTTTGCCCTGGTTTGAATGTCGTCATTAGAGAAATTGTTATGCACTTAAATTACAACT
ATTAGGTAATTAGTTAATTAACTAAATATAAAAACCGTTTTCTTTATTCTTACTAATTTA
ATTACCTGCATAAAAAAGGTTGAATAAATCTATGGAGCCAAATTTGGTTGGAAAGGTATT
TACGAGGAAGACTGGGTTCAATTAATTCCCAGCTAAATTAAAACTATCCATCACAGAGGT
GGTACCTTCATAGGAACTTCAAGAACTGGTTTTGATAGAGATAAAATTATTGAAACACTT
ATCAAGCACAATTTTAATTAGCTCTATGTCATCTGCGGAAACAGTATAAAACTCTTTTTA
AATAATTTATATATAATAATGAAATAAAATTTAAATTTCGTTCTAAACTTATTTTAAAAT
GAAATTCTAAACTTATTTTAAAATGAAAAGAATCCATGGGTCAAGTTCTTGAACTTTATT
ATGAAATCAGAAGAAGAAAACTCAATATTGGTGTTTGTAACATTCCAAGAAGCGTCGATA
ATGATATTCCTATTATCGATGAATCATTTGGTTATTAATCTTGTGTTGAAGTAAAAAAAT
TATTTTAAATTATTAATTTAATTTATTTAAATTTTGTTTTATGCTATTTGCAGGAAGCTT
AAAGAGTAATTGATAGTGCTTGGGTCGAATCTCGTTCCCATAGAAATGGTGTTGGTATTA
TTAGAGTTATGGGATAAAAGAGTGGATTTATTGCTATGGGTGCTTGTCTTGCATCTCGTT
GTGTAAATGTATGTTTGATCCCTGAATTTAATTACGATCTATATGGAAAGAGTGGTGTCC
TTGACTATATCAAATAGAGAATTATTAAGAAGGGTCATTGTATAGTTGTTGTTTCTGAAG
GAGCCAGTAATTAATTATACACAATTCTATAATAGTTTAACTTAATTTTTTTAAAAATAT
AGACAGCTCATTTGCTGATGCTGATGATGTTCCTGGTGATGTTGGTAAATTCTTATAAGA
TGAAATTCAAAAGTTTTGTGCTTAAGACAATACTGAAGTTACTGTAAAATATTTTGATCC
TTTATATATGCTTCGTGCTGTTAGAGCTAATGCTTATGACACCAAATAGTGCAGGTAAAT
AAATAAATATTCTATAAAGCTGTATTGTTTAATTTATTTTATAAATAAAGTACTCTTGCT
TAAAACGCAGTACATGGTTTAATGGCAGGTTTCACTGGGTTTTCTATTGGTCACGTCCAT
AACAAGGTAAAATGAATTATTTATTAGAATTTGTATAATTTAACAACTATTTTTAAAAAA
AGACTTGTTTCATACCTCTTGAAGAAATGCTTAGTGGAAATTATAGAAATAGAATAGTAG
CAAGTAACAAAAACTGGTAGAGATTACTAGCTTCTACTGGTTAGCCATCCTTCATCAATG
AAGAAGAATTAAAGAAAATAATTGGAACTAGCAAATAAGAATGA