Identifiers and Description

Gene Model Identifier

TTHERM_00170320

Standard Name

PFK1 (PhosphoFructoKinase)

Aliases

PreTt29743 | 14.m00310

Description

Alpha subunit of heterooctameric phosphofructokinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00170320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09983.14.998065322133077e-171hypothetical protein (764 aa)
OxytrichaContig14330.0.g571.0001043265246556e-154Phosphofructokinase
Stentor CoeruleusSteCoe_66672.6395702969591894e-66
WormBaseWBGene000221995.998633383648922e-18locus:pfk-1 6-phosphofructok
inase status:Confirmed Uni
Prot:Q9TZL8 protein_id:CCD71
595.1
SGDYGR240C3.001003044337619e-17PFK1 Alpha subunit of heterooc
tameric phosphofructokinase in
volved in glycolysis, indispen
sable for anaerobic growth, ac
tivated by fructose-2,6-bispho
sphate and AMP, mutation inhib
its glucose induction of cell
cycle-related genes
DictyBaseDDB_G02741119.997764199084386e-16pfkA on chromosome: 2 position
4510635 to 4513139

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00170320(coding)
ATGGATTTGTAAAAGAGTTTAACAGATAACAAGTTTTTCGTAGCCGGATTAGCATTAGGC
TCTGGATTAATTACTTCATTATTGTTGAAGTAATTCAATACTGAAGAAGAAAAAGTTGAA
AGAAAGGGAAGCCTTAAAACAGTCAAAAGAAAGGAAGTCAAGAAGCAAAGAACAGTTTTC
TTGCATCAAACTGATAACACTATCCCTAAAGAAATTCTTAATGCTAGCAACACTCTCATG
GAAGAAGTTAAGAATCTTGAAAGTAGAACTTGCAATATTTTAAAGGTTCCTAACTTGATC
ATTGAAGTCCCTCAAGATGAAATTCCATGCCATCTATCTCCCCTTTATGGTGAAAACAAT
TACAGAGAAGTCTTTGGTGGTGGTGGTTTCCTTCCAGACACTGCATTCGTTTACACTGGC
TCATACGTATTATCTGACGCTGTTATTGGTAAGAACCAGAGCTTAGATTAATCTAAGAGA
TACGTTCGTGCTGGTCCTAGAAAGCACAATTACTTTAATCCTTAATAGGTTAAGGCTGCC
ATCGTAACCTGTGGTGGTTTATGCCCTGGTTTGAATGTTGTTATTAGAGAAATATTCATG
TGTTTATACTTCAATTACGGTGTAAGAACTATCTATGGTATTAAATACGGATATAAGGGT
TTCTACTAATATGACTGGTAAGAACTTACTGTCAAGGATGTTAAGGAAATATAAAGACTT
GGTGGTACTGTTTTGGGTAGCTCTAGAGGTGGTTTTGATAAAGATAAAATTGTTGATAAT
TTAGTTAAGCATGGTATCACTCATGTTTACTGCTTAGGTGGTGACGGTACTCATAGAGGT
ATTTAAGCTCTTTTTAACGAAGTTAGAAGCAGAAAACTCAATATTAGTATCGTAGGTATT
CCAAAAACTATTGATAACGATATTCCAATTATAGATAAATCTTTCGGTTTTGAAACTTCA
GTTGAGGAAGCTGTTAAGGCAATCTAATCTGCTCATGTTGAAGCTCACTGTGCTGAATAT
GGTGTTGGTCTTGTCAGACTTATGGGTAGATATGCAGGTTTTATTGCTATGGAGGCAACT
AATGCTTCAAGAGATGCTCATGTTTGCTTAGTACCTGAATTCAAGTTTAATCTTTACGGT
GAGGAAGGTGTGTTAGAATACGTCTATCAAAGATTATTATCCAAAAGAAATTGTATTGTT
GTAGTTGCTGAAGGTGCTGGTGAAGCAGTTTTAGATGCACAATTTGCTAACACTGGTGAA
AAGGATGCTTCAGGAAATGCCAAGTTAAATGACATTGGTGCTTTCTTATAGAAGGAAATT
GTAGATTACGGTAAAAAGAAAGGAATGGAAGTCACTCTTAAATACATTAATCCCACATAC
ATGATTAGAACTGTACCAGCTAATGCTTTGGACAGAAAAATGTGCACATAACTTGCTTAA
AATGCAGTCCATGGTGCTATGGCAGGCTTTACTGGATTCACTGTTGGTCATGTTAATAAC
CGTTTGTGTTATATTCCATTAGACGAAATCTGTAAAGAAGGATCTGGAAGAAGAATCAAG
GCAGAAGATAGAGCTTGGTAGAGACTTCTTGCATCTACTGGCTAACCCTCCTTTTTAAAG
AAAGAAAATTGA


>TTHERM_00170320(protein)
MDLQKSLTDNKFFVAGLALGSGLITSLLLKQFNTEEEKVERKGSLKTVKRKEVKKQRTVF
LHQTDNTIPKEILNASNTLMEEVKNLESRTCNILKVPNLIIEVPQDEIPCHLSPLYGENN
YREVFGGGGFLPDTAFVYTGSYVLSDAVIGKNQSLDQSKRYVRAGPRKHNYFNPQQVKAA
IVTCGGLCPGLNVVIREIFMCLYFNYGVRTIYGIKYGYKGFYQYDWQELTVKDVKEIQRL
GGTVLGSSRGGFDKDKIVDNLVKHGITHVYCLGGDGTHRGIQALFNEVRSRKLNISIVGI
PKTIDNDIPIIDKSFGFETSVEEAVKAIQSAHVEAHCAEYGVGLVRLMGRYAGFIAMEAT
NASRDAHVCLVPEFKFNLYGEEGVLEYVYQRLLSKRNCIVVVAEGAGEAVLDAQFANTGE
KDASGNAKLNDIGAFLQKEIVDYGKKKGMEVTLKYINPTYMIRTVPANALDRKMCTQLAQ
NAVHGAMAGFTGFTVGHVNNRLCYIPLDEICKEGSGRRIKAEDRAWQRLLASTGQPSFLK
KEN


>TTHERM_00170320(gene)
ATGGATTTGTAAAAGAGTTTAACAGGTAAATTAGATATTTCACTTTGAAATTATCTTCTT
ACTAAGGCTAATACATTTTTATATTTAGATAACAAGTTTTTCGTAGCCGGATTAGCATTA
GGCTCTGGATTAATTACTTCATTATTGTTGAAGTAATTCAATACTGAAGAAGAAAAAGTT
GAAAGAAAGGGAAGCCTTAAAACAGTCAAAAGAAAGGAAGTCAAGAAGCAAAGAACAGTT
TTCTGTAAAATTTGAATTAACAAATTAGCATTTCTTACATTTGTTTTATAAATAACTTCA
AATAGTGCATCAAACTGATAACACTATCCCTAAAGAAATTCTTAATGCTAGCAACACTCT
CATGGAAGAAGTTAAGAATCTTGAAAGTAGAACTTGCAATATTTTAAAGGTTCCTAACTT
GATCATTGAAGTCGTAATACTTTGTCTTTTTTAGCATCATTTTTTAGTTAATTTTAACAA
TGCATTAAAATTTGATTAAATAATTTTAAGTCGCAACAACCAAACTGTGACTCTTAATAA
TATCCCACATTATCACGATGCACATAAAATGCTACAAATTAATAAAACTTCTTTAAATAT
AATGCATAACTAGTTAAGCCAGCACTATGAAAGTTTAATAAATAAATTTTAATGTATATC
AGCTATTAGCTTATCTATGAATTATTTTATAAAATATTATTTTAATGCCACTTTCAATTT
TACTTTTAAATTAATATAAAGCCTCAAGATGAAATTCCATGCCATCTATCTCCCCTTTAT
GGTGAAAACAATTACAGAGAAGTCTTTGGTGGTGGTGGTTTCCTTCCAGACACTGCATTC
GTTTACACTGGCTCATACGTATTATGTAATCAAAGATATTCAATTCCTATTAGAAAACTT
TCAAAATTTACCTTTCAGCCATTTTATAGAAAAAAATACAAACAAAAAAAAATAGAGTTT
TTTAAATCAATAAATCAAATCTAAGTTAATTAAATAAGTAAATAAACTCGAATAAAGATG
CATAAATTATATCAGATTCTATTTAGAGCAAACCTAATTATTAAATATTCCTTACATGAT
AATTGAGATTACTCTGTTTAAACAATACCTACCTATCAATAATAAATAAGTCCATAGCTA
TTTTTGATGCTAAAAGACTCGTTGAGATAAATAATATAAATGTTTTATAGATAAACTTGA
AATAAAATAAATACTATTTTGTTATATTAGATATAAAAATTATAATTAATTTTATAAACA
ATTGTGATAGAATTATATTAAAATATTTTGAATAATAAATAGCTGACGCTGTTATTGGTA
AGAACCAGAGCTTAGATTAATCTAAGAGATACGTTCGTGCTGGTCCTAGAAAGCACAATT
ACTTTAATCCTTAATAGGTTAAGGCTGCCATCGTAACCTGTGGTGGTTTATGCCCTGGTT
TGAATGTTGTTATTAGAGAAATATTCATGTGTTTATACTTCAATTACGGTGTAAGAACTA
TCTATGGTATTAAATACGGATATAAGGGTTTCTACTAATATGACTGGTAAGAACTTACTG
TCAAGGATGTTAAGGAAATATAAAGACTTGGTGGTACTGTTTTGGGTAGCTCTAGAGGTG
GTTTTGATAAAGATAAAATTGTTGATAATTTAGTTAAGCATGGTATCACTCATGTAAATT
ATATTTTTTGATAAAAGGCACTTTTTTTAAATATTCAAATTTTAATAAAATGATTTTAGG
TTTACTGCTTAGGTGGTGACGGTACTCATAGAGGTATTTAAGCTCTTTTTAACGAAGTTA
GAAGCAGAAAACTCAATATTAGTATCGTAGGTATTCCAAAAACTATTGATAACGATATTC
CAATTATAGATAAATCTTTCGGTTTTGAAACTTCAGTTGAGGTAAAAATTTATTTAATTA
TTTGAGTTATTTTTAGCTCCATATAAAAAGAAATTTAGGTAGATTTATTTACATTTTCAG
TATTATTTTAAATAGCATTTAGGAATTTAATTAAATAGGTTGATTTACTTACTTTAAAAT
ATAGCAAATTTTGAAAAAGAAAATTAAAAAATGAAAATATAAACTTATAATTTTAATTAA
TTAATTAATTAAAATAGGAAGCTGTTAAGGCAATCTAATCTGCTCATGTTGAAGCTCACT
GTGCTGAATATGGTGTTGGTCTTGTCAGACTTATGGGTAGATATGCAGGTTTTATTGCTA
TGGAGGCAACTAATGCTTCAAGAGATGCTCATGTTTGCTTAGTACCTGAATTCAAGTTTA
ATCTTTACGGTGAGGAAGGTGTGTTAGAATACGTCTATCAAAGATTATTATCCAAAAGAA
ATTGTATTGTTGTAGTTGCTGAAGGTGCTGGTGAAGCAGTTTTAGATGCACAATTTGCTA
ACACTGGTGAAAAGGATGCTTCAGGAAATGCCAAGTTAAATGTAAAAATAAAATTTAGAG
AAAAAAGAGTGATATTTATTTGAATATCTTTTTTAAAATAAATAGGACATTGGTGCTTTC
TTATAGAAGGAAATTGTAGATTACGGTAAAAAGAAAGGAATGGAAGTCACTCTTAAATAC
ATTAATCCCACATACATGATTAGAACTGTACCAGCTAATGCTTTGGACAGAAAAATGTGC
ACGTAAGTGATAAATTAAAATAATAAAAAAATAATTAAAACTTTAATTTTAAAAGATAAC
TTGCTTAAAATGCAGTCCATGGTGCTATGGCAGGCTTTACTGGATTCACTGTTGGTCATG
TTAATAACCGTTTGTGTTATATTCCATTAGACGAAATCTGTAAAGAAGGATCTGGAAGAA
GAATCAAGGCAGAAGATAGAGCTTGGTAGAGACTTCTTGCATCTACTGGCTAACCCTCCT
TTTTAAAGAAAGAAAATTGA