Identifiers and Description

Gene Model Identifier

TTHERM_00328570

Standard Name

PET1 (E3 ubiquitin ligase)

Aliases

PreTt30261 | 33.m00273 | 3705.m00100

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 73.7%

TetraMine Data

TTHERM_00328570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40954.12.999180586171967e-98hypothetical protein (1035 aa)
WormBaseWBGene000072260.0000000020002373268528243status:Confirmed UniProt:Q17
573 protein_id:CAA84635.1
OxytrichaContig3298.0.g700.000000030002053728821195Ring finger domain
DictyBaseDDB_G02848070.000009999254677478949DDB_G0284807 on chromosome: 4
position 2501891 to 2505360
SGDYOL013C0.000009999254677478949HRD1 Ubiquitin-protein ligase
required for endoplasmic retic
ulum-associated degradation (E
RAD) of misfolded proteins; ge
netically linked to the unfold
ed protein response (UPR); reg
ulated through association wit
h Hrd3p; contains an H2 ring f
inger
Stentor CoeruleusSteCoe_306980.000045399929762484854

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00328570(coding)
ATGAGCATCTCAGCAAAAACAAAAAACGCATTCTGTATTTGTTGGTTACTTATAATCACT
TAGACATATAGTTAGCAATAAAATTCTACAAATACTTCAAATTAAACTTAAAAATATTAG
GTTTTTGGGTCAAATTATTTGTATTAAGTCAACCAAAATCTAAGTGCCCAAACTTTTTAG
CTTTCATTATCAAATAGCTATTTCAGTCAGAGATATATTGTGATAGATATAATTATACTG
TCAAAGCAGGATTCATAATTTTAGTTTATATCTTGTTTAAACTACAATCAAGACCCTTTG
TAACAAGATTCGTTTGTTAATTAGGGCCAATATAATTGCAGCTTTACTGATTAGGTCGCT
TAATAGTAGAATTTGGCTTAGCAACTTCTAATTATAGATACGAGCGATCCTTCTTATCAA
TAAAATAACACAATTTACCTAACAGTGCTATACTAATCCACTAATAGCATTTAAAAAGCT
TCTTTAATACCCTTACCTTAACCAATTAATTATGATGTGTATGTTTATTACTACAGTAAA
GTACCATGTCATAGCAGCTGCAACGGTTTAAATGGTTATTGTAATGATTAAACTGGGGTT
TGCAGTTGCAATTAATTCTACACTGGAGCTGATTGTGGCTTGTACTTAAATCCTTTAAAT
ATTCAAAATGATAAAGACAGTACATACATAACAATTTAGCCACGATCCCAATACACTTTT
TCGATAAACATGACAAACATTATTTAGAAAGCTTAAGGATAAAACATTTAATTTTCTCTT
AAAAAGATATATGGGGCATCTAATTTAAATATTTATATGCTTTTTAATCAAAACTAATAA
CCTTCTCCAGATTAATATTAAATGTATTATTCGATGGCTAATAGCTATATGAATATTTCA
AATGTAGACAGTTTGTGCAGTCAATTTTAAAACAGCACAAATAGCTTAAGCAATAATTCT
TAATAACCTTAATCAAATCAATGCTTTATCGTATTTAATATGTAACAATTATCAAACTCA
AAGCTATCTATTATTGTGAATTTTGGTATTAATATTTTAGCTAATACTACTACAAATTCT
GCGACTTCTAACTCAACTTAAAATAATATAAATAATAATACTAACTTAAGAGATCCTAAA
TCTATAACTGGGAACAACTCAGGTAGCAACAGCACATATAGTACTTCACTAACAACAGAT
GTACAATCAAAGTATTAAGCATATGAAATAACAATTTATGTTTTAGTTGGCTTAGCATTT
ATTTTCGTAGCCTTTTTATTACTATTTACTGTATGCAGAAGATGCTAAAAAATGCTTGAA
AGTAGGTATCTAAGTCAACAGTAAGAATAAATTCGAAATGATTAAGAAAATTAATAACAA
CAAGCAAATAATCCAGATTTACTCATAAATTTACAATTGAGATTAAAAATATAATAAAAA
AAAAAGCTCATTCTATCAAAGAAACGTGCACTTTAGAATTATTTAATGCCAAGTATACCT
TTCTAATCATAAACAAGAACATAATTAGATTAAAGCGTACTAGCTGAAAGTGCATTAGAT
AAAGTATCATAAGAAGAAACTTAAAAATAGAAAAGAAAAAATCAAAAAGATAACTTATAA
CTGTAAGATTTGGAGACAAATCTTAATAAGTCAGTTTAGTTGAATACAAGCTTAAATAGC
AGTAAATAATGTTGCTCAATATGTTTAATTGAATTTGTGCCCTAAGAAAAAGTTCAAAAA
ACAATCTGCAGTCATACTTTTCACATCGAATGCATTTAAGATTGGATTTAAAAGAATGAT
AATTGTCCTCTCTGCAGATAGAGTTTTGATATATTAGATATGATAGATTATTTAGCCAAA
GAAAAATTAGCTTAAGCTGAGAATAAAGACTAATAGCTTGCTATCATATAGAATAAGAAT
AAAATTGAAGACATCCTATTAACATAAAAGGAACAAATCATTTAATTTACGGATGATGAT
TTTTTGACTATTTTTAAATTTTTCAAGATAGATAAAGAATTAATCATTCAAAAATAACCA
AAACAACAAAATGCTTAACCAGTAGCTAATACTTAAAGCGATAAAATAACCAAAGATGAA
AAAGCTTTTAAGCTAGAAGAATCTAACGCATTACTTAATTAAAATTATGACTAAGTTACT
TGCTTAAGCCCTACTTATTTGTCAACTCTCTCTTCACCTGTAAGCAAATTTTAAAGCGTA
TATGTTCAATAATAACTTATTTAGTCACCAACAGCAGAATTACCATAACACTCATAGAAT
CCAAGCATTTTTACATTATAAAAATTCTCATAAAACTAATAAGAGTTAAATGCATAAAAT
AATTAGAAAAATACTCACAAATCTATTGATAACATTCCAGAAGAAGTCAGTTATCCAATT
TAAAATTAAAATTACTTTTCTAGTAAGAGCTAAGTATTCACCAAAAAAACTTTGAATCTA
AAAAATAAGAATTCTATTACACATAACCATTTGAAAATGTAAGATGAAAATTAAAACTAA
TATTAAAACTTTGCTAATAACGAAGAGCAAAAAGATGAATAAAATTAAGAATATTCAGAA
AATTAAAACAATTTCTCAAGCTTTTAAAATTAAACTGGAAATTAAAAAATATTTACTTCA
TAAAAAAGTTGA


>TTHERM_00328570(protein)
MSISAKTKNAFCICWLLIITQTYSQQQNSTNTSNQTQKYQVFGSNYLYQVNQNLSAQTFQ
LSLSNSYFSQRYIVIDIIILSKQDSQFQFISCLNYNQDPLQQDSFVNQGQYNCSFTDQVA
QQQNLAQQLLIIDTSDPSYQQNNTIYLTVLYQSTNSIQKASLIPLPQPINYDVYVYYYSK
VPCHSSCNGLNGYCNDQTGVCSCNQFYTGADCGLYLNPLNIQNDKDSTYITIQPRSQYTF
SINMTNIIQKAQGQNIQFSLKKIYGASNLNIYMLFNQNQQPSPDQYQMYYSMANSYMNIS
NVDSLCSQFQNSTNSLSNNSQQPQSNQCFIVFNMQQLSNSKLSIIVNFGINILANTTTNS
ATSNSTQNNINNNTNLRDPKSITGNNSGSNSTYSTSLTTDVQSKYQAYEITIYVLVGLAF
IFVAFLLLFTVCRRCQKMLESRYLSQQQEQIRNDQENQQQQANNPDLLINLQLRLKIQQK
KKLILSKKRALQNYLMPSIPFQSQTRTQLDQSVLAESALDKVSQEETQKQKRKNQKDNLQ
LQDLETNLNKSVQLNTSLNSSKQCCSICLIEFVPQEKVQKTICSHTFHIECIQDWIQKND
NCPLCRQSFDILDMIDYLAKEKLAQAENKDQQLAIIQNKNKIEDILLTQKEQIIQFTDDD
FLTIFKFFKIDKELIIQKQPKQQNAQPVANTQSDKITKDEKAFKLEESNALLNQNYDQVT
CLSPTYLSTLSSPVSKFQSVYVQQQLIQSPTAELPQHSQNPSIFTLQKFSQNQQELNAQN
NQKNTHKSIDNIPEEVSYPIQNQNYFSSKSQVFTKKTLNLKNKNSITHNHLKMQDENQNQ
YQNFANNEEQKDEQNQEYSENQNNFSSFQNQTGNQKIFTSQKS


>TTHERM_00328570(gene)
ATGAGCATCTCAGCAAAAACAAAAAACGCATTCTGTATTTGTTGGTTACTTATAATCACT
TAGACATATAGTTAGCAATAAAATTCTACAAATACTTCAAATTAAACTTAAAAATATTAG
GTTTTTGGGTCAAATTATTTGTATTAAGTCAACCAAAATCTAAGTGCCCAAACTTTTTAG
CTTTCATTATCAAATAGCTATTTCAGTCAGAGATATATTGTGATAGATATAATTATACTG
TCAAAGCAGGATTCATAATTTTAGTTTATATCTTGTTTAAACTACAATCAAGACCCTTTG
TAACAAGATTCGTTTGTTAATTAGGGCCAATATAATTGCAGCTTTACTGATTAGGTCGCT
TAATAGTAGAATTTGGCTTAGCAACTTCTAATTATAGATACGAGCGATCCTTCTTATCAA
TAAAATAACACAATTTACCTAACAGTGCTATACTAATCCACTAATAGCATTTAAAAAGCT
TCTTTAATACCCTTACCTTAACCAATTAATTATGATGTGTATGTTTATTACTACAGTAAA
GTACCATGTCATAGCAGCTGCAACGGTTTAAATGGTTATTGTAATGATTAAACTGGGGTT
TGCAGTTGCAATTAATTCTACACTGGAGCTGATTGTGGCTTGTACTTAAATCCTTTAAAT
ATTCAAAATGATAAAGACAGTACATACATAACAATTTAGCCACGATCCCAATACACTTTT
TCGATAAACATGACAAACATTATTTAGAAAGCTTAAGGATAAAACATTTAATTTTCTCTT
AAAAAGATATATGGGGCATCTAATTTAAATATTTATATGCTTTTTAATCAAAACTAATAA
CCTTCTCCAGATTAATATTAAATGTATTATTCGATGGCTAATAGCTATATGAATATTTCA
AATGTAGACAGTTTGTGCAGTCAATTTTAAAACAGCACAAATAGCTTAAGCAATAATTCT
TAATAACCTTAATCAAATCAATGCTTTATCGTATTTAATATGTAACAATTATCAAACTCA
AAGCTATCTATTATTGTGAATTTTGGTATTAATATTTTAGCTAATACTACTACAAATTCT
GCGACTTCTAACTCAACTTAAAATAATATAAATAATAATACTAACTTAAGAGATCCTAAA
TCTATAACTGGGAACAACTCAGGTAGCAACAGCACATATAGTACTTCACTAACAACAGAT
GTACAATCAAAGTATTAAGCATATGAAATAACAATTTATGTTTTAGTTGGCTTAGCATTT
ATTTTCGTAGCCTTTTTATTACTATTTACTGTATGCAGAAGATGCTAAAAAATGCTTGAA
AGTAGGTATCTAAGTCAACAGTAAGAATAAATTCGAAATGATTAAGAAAATTAATAACAA
CAAGCAAATAATCCAGATTTACTCATAAATTTACAATTGAGATTAAAAATATAATAAAAA
AAAAAGCTCATTCTATCAAAGAAACGTGCACTTTAGAATTATTTAATGCCAAGTATACCT
TTCTAATCATAAACAAGAACATAATTAGATTAAAGCGTACTAGCTGAAAGTGCATTAGAT
AAAGTATCATAAGAAGAAACTTAAAAATAGAAAAGAAAAAATCAAAAAGATAACTTATAA
CTGTAAGATTTGGAGACAAATCTTAATAAGTCAGTTTAGTTGAATACAAGCTTAAATAGC
AGTAAATAATGTTGCTCAATATGTTTAATTGAATTTGTGCCCTAAGAAAAAGTTCAAAAA
ACAATCTGCAGTCATACTTTTCACATCGAATGCATTTAAGATTGGATTTAAAAGAATGAT
AATTGTCCTCTCTGCAGATAGAGTTTTGATATATTAGATATGATAGATTATTTAGCCAAA
GAAAAATTAGCTTAAGCTGAGAATAAAGACTAATAGCTTGCTATCATATAGAATAAGAAT
AAAATTGAAGACATCCTATTAACATAAAAGGAACAAATCATTTAATTTACGGATGATGAT
TTTTTGACTATTTTTAAATTTTTCAAGATAGATAAAGAATTAATCATTCAAAAATAACCA
AAACAACAAAATGCTTAACCAGTAGCTAATACTTAAAGCGATAAAATAACCAAAGATGAA
AAAGCTTTTAAGCTAGAAGAATCTAACGCATTACTTAATTAAAATTATGACTAAGTTACT
TGCTTAAGCCCTACTTATTTGTCAACTCTCTCTTCACCTGTAAGCAAATTTTAAAGCGTA
TATGTTCAATAATAACTTATTTAGTCACCAACAGCAGAATTACCATAACACTCATAGAAT
CCAAGCATTTTTACATTATAAAAATTCTCATAAAACTAATAAGAGTTAAATGCATAAAAT
AATTAGAAAAATACTCACAAATCTATTGATAACATTCCAGAAGAAGTCAGTTATCCAATT
TAAAATTAAAATTACTTTTCTAGTAAGAGCTAAGTATTCACCAAAAAAACTTTGAATCTA
AAAAATAAGAATTCTATTACACATAACCATTTGAAAATGTAAGATGAAAATTAAAACTAA
TATTAAAACTTTGCTAATAACGAAGAGCAAAAAGATGAATAAAATTAAGAATATTCAGAA
AATTAAAACAATTTCTCAAGCTTTTAAAATTAAACTGGAAATTAAAAAATATTTACTTCA
TAAAAAAGTTGA