Identifiers and Description

Gene Model Identifier

TTHERM_00705040

Standard Name

PELO1 (PELOta 1)

Aliases

PreTt26859 | 111.m00080 | 3744.m00001

Description

eRF1 domain 3 family protein; homolog of protein pelota; functions in mRNA surveillance pathways of non-stop and no-go decay

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00705040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17708.19.997093137033517e-262eRF1 domain 3 family protein (
447 aa)
DictyBaseDDB_G02804475.000356947592888e-100pelo on chromosome: 3 position
3368362 to 3369914
WormBaseWBGene000112809.999030951775615e-88Uncharacterized protein R74.6
status:Confirmed UniProt:P
50444 protein_id:CAA85277.1
OxytrichaContig17990.0.g101.999469658314961e-75eRF1 domain 2
SGDYNL001W3.000235161122315e-61DOM34 Protein that, with bindi
ng partner Hbs1p, facilitates
ribosomal subunit dissociation
when translation is stalled;
required for RNA cleavage in n
o-go decay, but reports confli
ct on endonuclease activity; P
elota ortholog
Stentor CoeruleusSteCoe_372742.2273635617957438e-39

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000381

Sequences

>TTHERM_00705040(coding)
ATGAGAATTATAAAAAGATATATTAGCAAGGGCGAAGGCTATTTAACTTTAGTTCCTACT
GAGGAAGAAGATTACTGGCACATTTATAACTTAGTTTCTAACGGTGATATTGTCCGTTCT
GCAACTTTCAGAAAGATAACCAAGGAGTCAAAGACAGGAGTTAAAGATGTCATTAAAAAG
AAAATTACTCTCACTTTGAAGATCGTTGCTATTAATTACTATGCAGGCGAGTTCCTGCAA
CTTTCTTTGAAGGGAAGAAACATAAAAGAAAATGATTACCTAAAGATGGGTTAATTCCAT
ACTTTTAATTTAGAATTAGACTAGCAGATTACTATCATTAAATAAAATTGGGATTCTTTC
CATTTTAAGATTATTAAGGATATTTCTGACCCTACTCATGATTCAGAACTAGCTGCATTT
GTTATGGATGAAGGAATAGCACATTTGTGTTTCATAAAATCTTCAATTACAATAATGAAG
CATAAAATAGAAAAGCACATACCTAAGAAGAAGAGTGGAGCCGAGCAACATGACAAGGCA
ATGGAAAAGTTCTTCGAAACCTGCTTTGAGTATTTGGTAACTGTTAATTATGATTAAATA
AAGTGCCTTGTTATTGCTTCTCCTGGTTATGTGAAAGATGATTTCTACAAATATATATAA
GATTAGTTGCAGAGAGCGGATCTAGCTGCATTCAACAAGAGGTCAAACTTCCTTTAAAAG
ATAGTCAGAGCTAAGTCATCAACAGGATATTTGAATAGTTTAAGTGAAGTATTGAGTGAC
CCCACTATCTAAGAGTAGTTAAAAGATACAAAGGCTATCAAAGAAGTGAGAGCTCTAGAT
GATTTTTACAAGGTTATGAGTAAAGATCCTGATATGGTTTGCTATGGATAAAAGCATGTA
TTTAAAGCATACGAAGATAATGCTATTTAAACCTTACTTTTGAGTGACAGTCTTTTTAGA
ATTAAAGATTTGAGTTAACGTAAAAAATTCAATAATTTGATCGATGACACTAAGAAGAAG
GGAATTGACTCTTTGATTTTCTCTAGTTTGCACAGTAGTGGAGAAAAATTAAATAATTTA
ACAGGTATAGCAGCTATCCTTAGATATCCTATCCCTTATGAAGACGAAGAGATGGAGTAA
TCTGAAGAAATAGTTGAAAATTTTAGAGTAAAGATAGAAGAAAGAGAAGAAGTCGAAGAC
GAAAAATCCATTATGGGAGATGATGAAAAATTAGAAGCTGAAAGAATAGCAAAAGAGTTA
GAAGCATTTTCTTTAGATAATTTAGACGAAGAACAAAAGCAAGATGAAGACGAAAATCTT
TGA


>TTHERM_00705040(protein)
MRIIKRYISKGEGYLTLVPTEEEDYWHIYNLVSNGDIVRSATFRKITKESKTGVKDVIKK
KITLTLKIVAINYYAGEFLQLSLKGRNIKENDYLKMGQFHTFNLELDQQITIIKQNWDSF
HFKIIKDISDPTHDSELAAFVMDEGIAHLCFIKSSITIMKHKIEKHIPKKKSGAEQHDKA
MEKFFETCFEYLVTVNYDQIKCLVIASPGYVKDDFYKYIQDQLQRADLAAFNKRSNFLQK
IVRAKSSTGYLNSLSEVLSDPTIQEQLKDTKAIKEVRALDDFYKVMSKDPDMVCYGQKHV
FKAYEDNAIQTLLLSDSLFRIKDLSQRKKFNNLIDDTKKKGIDSLIFSSLHSSGEKLNNL
TGIAAILRYPIPYEDEEMEQSEEIVENFRVKIEEREEVEDEKSIMGDDEKLEAERIAKEL
EAFSLDNLDEEQKQDEDENL


>TTHERM_00705040(gene)
ATGAGAATTATAAAAAGATATATTAGCAAGGGCGAAGGCTATTTAACTTTAGTTCCTACT
GAGGAAGAAGATTACTGGCACATTTATAACTTAGTTTCTAACGGTGATATTGTCCGTTCT
GCAACTTTCAGAAAGATAACCAAGGAGTCAAAGACAGGAGTTAAAGATGTCATTAAAAAG
AAAATTACTCTCACTTTGAAGATCGTTGCTATTAATTACTATGCAGGCGAGTTCCTGCAA
CTTTCTTTGAAGGGAAGAAACATAAAAGAAAATGATTACCTAAAGATGGGTTAATTCCAT
ACTTTTAATTTAGAATTAGACTAGCAGATTACTATCATTAAATAAAATTGGGATTCTTTC
CATTTTAAGATTATTAAGGATATTTCTGACCCTACTCATGATTCAGAACTAGCTGCATTT
GTTATGGATGAAGTAATCAAAATTTTTTATTAAATTTAAAGTTTGTTTGAATTTCAACAA
CTAAGAAAAGAAATGTTAAATGCTTTTTGAAATATAGAAAAAAATTAATTAGTTTGTTTT
TGTAATGATGAATTATTTAATAAATGATAGGGAATAGCACATTTGTGTTTCATAAAATCT
TCAATTACAATAATGAAGCATAAAATAGAAAAGCACATACCTAAGAAGAAGAGTGGAGCC
GAGCAACATGACAAGGCAATGGAAAAGTTCTTCGAAACCTGCTTTGAGTATTTGGTAACT
GTTAATTATGATTAAATAAAGTGCCTTGTTATTGCTTCTCCTGGTTATGTGAAAGATGAT
TTCTACAAATATATATAAGATTAGTTGCAGAGAGCGGATCTAGCTGCATTCAACAAGAGG
TCAAACTTCCTTTAAAAGATAGTCAGAGCTAAGTCATCAACAGGATATTTGAATAGTTTA
AGTGAAGTATTGAGTGACCCCACTATCTAAGAGTAGTTAAAAGATACAAAGGCTATCAAA
GAAGTGAGAGCTCTAGATGATTTTTACAAGGTATCAAAGATATGAATTATTTTATTAAAT
AGAATGAAAGTGTTTTTATTTATTGCTTTAAATAATTTTATTAATTACAAAATAGGTTAT
GAGTAAAGATCCTGATATGGTTTGCTATGGATAAAAGCATGTATTTAAAGCATACGAAGA
TAATGCTATTTAAACCTTACTTTTGAGTGACAGTCTTTTTAGAATTAAAGATTTGAGTTA
ACGTAAAAAATTCAATAATTTGATCGATGACACTAAGAAGAAGGGAATTGACTCTTTGAT
TTTCTCTAGTTTGCACAGTAGTGGAGAAAAATTAAATAATTTAACAGGTATAGCAGCTAT
CCTTAGATATCCTATCCCTTATGAAGACGAAGAGATGGAGTAATCTGAAGAAATAGTTGA
AAATTTTAGAGTAAAGATAGAAGAAAGAGAAGAAGTCGAAGACGAAAAATCCATTATGGG
AGATGATGAAAAATTAGAAGCTGAAAGAATAGCAAAAGAGTTAGAAGCATTTTCTTTAGA
TAATTTAGACGAAGAACAAAAGCAAGATGAAGACGAAAATCTTTGA