Identifiers and Description

Gene Model Identifier

TTHERM_00328580

Standard Name

PEL1 (E3 ubiquitin ligase)

Aliases

PreTt30262 | 33.m00274 | 3705.m00101

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00328580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40954.16.002270911168926e-31hypothetical protein (1035 aa)
WormBaseWBGene000171440.000000019990673443141236Uncharacterized RING finger pr
otein EEED8.16 status:Confir
med UniProt:Q95QN6 protein
_id:CCD68743.1
OxytrichaContig952.1.g150.00000019998969434520019Ring finger domain
DictyBaseDDB_G02800030.000005998506718272351DDB_G0280003 on chromosome: 3
position 2849525 to 2853250
SGDYKL034W0.000019995566179747357TUL1 Golgi-localized RING-fing
er ubiquitin ligase (E3), invo
lved in ubiquitinating and sor
ting membrane proteins that co
ntain polar transmembrane doma
ins to multivesicular bodies f
or delivery to the vacuole for
quality control purposes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00328580(coding)
ATGAGAATCTCTTAAGCTAATTTAATCATTTTCTATCTTTGCCTCTTCTAATTTGCATTG
TGCTAACAATAATCTACTAAATAAGAGAGCACTTAAAGCATCTTTCCTAATTATAACTAT
TTATTTAGCTAATTCTCTTATTACAAGATTTACTAAATAGATTTATAATAACACTTTTAC
GAGAACTATGAATATATCGCCTTTTAAATAGACATCATATCTTAATTCATTCCTCAATAA
AACATCACTGTATGTCTTAACTTTGAATAGAATGAAGAATAACTTTAGAATAGTCTAAAT
ATGAATAATTTCTATTGTGAAATTACTGACCTCATCGCAACAAAAGAGTAGCTAACTTAG
CATTTGCTTTATGTTAATGCTAAAAGTCCTGCATTCTAAAATTCTCTTAAAGCAAATCTC
GTAGTTTTTAACTCAATCAAAGGAGTAACAGTTAATTCATAGATCTATATAAAATATAAC
ATGAAAGTACAATTACTAAACAAAAAATTATGCCATAACTCTTGTAGCGGAATAAATGGA
AATTGCAACAGAGAAACAGGATAATGCGTTTGCAATAAAAATTTTATTGGATATGATTGC
CATATTAAATTACAAGAAATTAATTTCACTAAGAATTAAGATTCAATTTACTTATATTTA
TTATAATAAACATCCTAATACGCTATTGTGAACATGGATTATCTTATATAAAACTACTAA
CAAAGCAGCTTTTCATTATAATTAGCTAGGTCTATTGAATATAATGAAATAAATATTTAT
ATGACTTTCAACAAATTAGAAAATCCAACAATTGATTCTTTTTAAGAAAAATTTTTAATG
CAAAACAAAGAATATTCAATTCAAAATATTGAACAGCTCTGTTAAAAATATTAATCTAAC
ATTTAATAACAATAAGAACACACTTTATAAGACTAAACTATAAACAACTAACAAGAAATG
AATTCAAATACATGCTTCTTTATTATTGAGCTCAAATAATAGCAATATGGTAATAACATG
GCTTTAAAATTGAGCGTTTAGATTTCAAAAAAACAAAACAACTCAAATACCTAACAATAA
AACTTTAATGAAAACGGAATGCAAAACATGAGTGATGATAGTAATGCAATTAAACTTTCA
AAATTAATCGCCATATCCACATCATCTCTCTTTTTAGGTTCAATCTTGCTTTTGTTTGTC
TTCAAAATATTGAAAAACAAAAAAGAAGTGAGCTAATAATTGTTAACAACTAACTTAGAA
GAGACTAAAAATGAATAGCTTTGCAATTCTGTTGTAATAAAAAATATTTTACACCAATAA
ACATAACTCATCTAGAAAAAAAATAAATAAATCTAAAAATAGAAATTACTCATATAAAAT
TTAATGCCTATTACTAAATATTAATCATAAAACAAATAAACAAGTGATTCATCAATTATT
ATTCTCTAAGAATAAAATTAAGAATAAGAAATTAAATAGAAAATTTAAGAATAAGAACAG
AAAGAAAATTTTAAGTAATTCAGCTGCATTATTTAAATAGATGATTTAGAAAATAATAAC
TCTTAAAAGTAAAATAAAACTAGTATTTCTGAAAGTATTTGCTGCGCTATGTGCTTAACT
GAGCTAGTAAATGATGACTAAATAATAAAAACTATTTGTGATCACAGTTTCCATGCCTAA
TGTTTTCAAGAGTGGATTAATAAGAACGACGAATGCCCCTTATGCAGAGAAAGTTTTGAA
ATATTTAATCTCCTTGATTACATGACAGAAAGAAAATTTTTAACTCTCAAAAAAAGATGT
GATAAATATTACTGTGTCTTAGAAAGAAACTAAATCCTTGAAAAACTAAAAACTTAATTT
GACTTAATTTTAAGCCTCCCTGATGAATAATTTTTAGATATCTTCAAATATTTCTAAGTT
GAATAATAAGAAAACAAGTAGTAAATAGAGTAGTAAGAGACTATAGAATAATTTAATGGA
GTAGAAAAAATAGGCTAATAAAAGTAAAATTTCTAACTAGTTATCCGCCAAAATGGAGAT
TCCTCAAATTAAATGGGCAATAGTTGCGTTAGCACATGTAGACTTTCTTAAAGATGTTCT
ATATTTTCAAACTAAAATTTGGTTTAGTCAAAAAGAAATTCTTTTTCAAGCTAAAACGAA
TAATAAGAATAATAATAAAATAAGCAATCAAGCTCTAATTCAATTGATACTCCATACGCC
TAATAAAATTCATAAAAACTCCTTCTTAATTCTAAATAATAAAAATATTTTTAAAAGAAT
GCCCCTAAAATACTACAAGTCGAGAATTAAATAGAGAAACTCTTTTAACTAAAAACTCAT
AGAAAAGTTAATAATTTAATTGATGCTTAAGAAACCTACAGAATACCTTCAGATTGCCTT
ACCCAACAAACTCAAATGAATTAAATTTTACTAAGCAGTACTAATAATTCAACTAATTCC
AAAAATTAAAATGAAGCTAAGAAAAAAATCAATGCAAATAAACTAAAAAATTAAATACTA
AAATAATAGTCTTTTAATGTTAATCATTAATAAGCTAAATCAAATAGAATGTCTTTAAAA
TAACCAATAACCTTAACCGAAGAAGCTAAAGGAACATAATACAGCCAATGA


>TTHERM_00328580(protein)
MRISQANLIIFYLCLFQFALCQQQSTKQESTQSIFPNYNYLFSQFSYYKIYQIDLQQHFY
ENYEYIAFQIDIISQFIPQQNITVCLNFEQNEEQLQNSLNMNNFYCEITDLIATKEQLTQ
HLLYVNAKSPAFQNSLKANLVVFNSIKGVTVNSQIYIKYNMKVQLLNKKLCHNSCSGING
NCNRETGQCVCNKNFIGYDCHIKLQEINFTKNQDSIYLYLLQQTSQYAIVNMDYLIQNYQ
QSSFSLQLARSIEYNEINIYMTFNKLENPTIDSFQEKFLMQNKEYSIQNIEQLCQKYQSN
IQQQQEHTLQDQTINNQQEMNSNTCFFIIELKQQQYGNNMALKLSVQISKKQNNSNTQQQ
NFNENGMQNMSDDSNAIKLSKLIAISTSSLFLGSILLLFVFKILKNKKEVSQQLLTTNLE
ETKNEQLCNSVVIKNILHQQTQLIQKKNKQIQKQKLLIQNLMPITKYQSQNKQTSDSSII
ILQEQNQEQEIKQKIQEQEQKENFKQFSCIIQIDDLENNNSQKQNKTSISESICCAMCLT
ELVNDDQIIKTICDHSFHAQCFQEWINKNDECPLCRESFEIFNLLDYMTERKFLTLKKRC
DKYYCVLERNQILEKLKTQFDLILSLPDEQFLDIFKYFQVEQQENKQQIEQQETIEQFNG
VEKIGQQKQNFQLVIRQNGDSSNQMGNSCVSTCRLSQRCSIFSNQNLVQSKRNSFSSQNE
QQEQQQNKQSSSNSIDTPYAQQNSQKLLLNSKQQKYFQKNAPKILQVENQIEKLFQLKTH
RKVNNLIDAQETYRIPSDCLTQQTQMNQILLSSTNNSTNSKNQNEAKKKINANKLKNQIL
KQQSFNVNHQQAKSNRMSLKQPITLTEEAKGTQYSQ


>TTHERM_00328580(gene)
AAATTAAAAAAAACATAAATGAGAATCTCTTAAGCTAATTTAATCATTTTCTATCTTTGC
CTCTTCTAATTTGCATTGTGCTAACAATAATCTACTAAATAAGAGAGCACTTAAAGCATC
TTTCCTAATTATAACTATTTATTTAGCTAATTCTCTTATTACAAGATTTACTAAATAGAT
TTATAATAACACTTTTACGAGAACTATGAATATATCGCCTTTTAAATAGACATCATATCT
TAATTCATTCCTCAATAAAACATCACTGTATGTCTTAACTTTGAATAGAATGAAGAATAA
CTTTAGAATAGTCTAAATATGAATAATTTCTATTGTGAAATTACTGACCTCATCGCAACA
AAAGAGTAGCTAACTTAGCATTTGCTTTATGTTAATGCTAAAAGTCCTGCATTCTAAAAT
TCTCTTAAAGCAAATCTCGTAGTTTTTAACTCAATCAAAGGAGTAACAGTTAATTCATAG
ATCTATATAAAATATAACATGAAAGTACAATTACTAAACAAAAAATTATGCCATAACTCT
TGTAGCGGAATAAATGGAAATTGCAACAGAGAAACAGGATAATGCGTTTGCAATAAAAAT
TTTATTGGATATGATTGCCATATTAAATTACAAGAAATTAATTTCACTAAGAATTAAGAT
TCAATTTACTTATATTTATTATAATAAACATCCTAATACGCTATTGTGAACATGGATTAT
CTTATATAAAACTACTAACAAAGCAGCTTTTCATTATAATTAGCTAGGTCTATTGAATAT
AATGAAATAAATATTTATATGACTTTCAACAAATTAGAAAATCCAACAATTGATTCTTTT
TAAGAAAAATTTTTAATGCAAAACAAAGAATATTCAATTCAAAATATTGAACAGCTCTGT
TAAAAATATTAATCTAACATTTAATAACAATAAGAACACACTTTATAAGACTAAACTATA
AACAACTAACAAGAAATGAATTCAAATACATGCTTCTTTATTATTGAGCTCAAATAATAG
CAATATGGTAATAACATGGCTTTAAAATTGAGCGTTTAGATTTCAAAAAAACAAAACAAC
TCAAATACCTAACAATAAAACTTTAATGAAAACGGAATGCAAAACATGAGTGATGATAGT
AATGCAATTAAACTTTCAAAATTAATCGCCATATCCACATCATCTCTCTTTTTAGGTTCA
ATCTTGCTTTTGTTTGTCTTCAAAATATTGAAAAACAAAAAAGAAGTGAGCTAATAATTG
TTAACAACTAACTTAGAAGAGACTAAAAATGAATAGCTTTGCAATTCTGTTGTAATAAAA
AATATTTTACACCAATAAACATAACTCATCTAGAAAAAAAATAAATAAATCTAAAAATAG
AAATTACTCATATAAAATTTAATGCCTATTACTAAATATTAATCATAAAACAAATAAACA
AGTGATTCATCAATTATTATTCTCTAAGAATAAAATTAAGAATAAGAAATTAAATAGAAA
ATTTAAGAATAAGAACAGAAAGAAAATTTTAAGTAATTCAGCTGCATTATTTAAATAGAT
GATTTAGAAAATAATAACTCTTAAAAGTAAAATAAAACTAGTATTTCTGAAAGTATTTGC
TGCGCTATGTGCTTAACTGAGCTAGTAAATGATGACTAAATAATAAAAACTATTTGTGAT
CACAGTTTCCATGCCTAATGTTTTCAAGAGTGGATTAATAAGAACGACGAATGCCCCTTA
TGCAGAGAAAGTTTTGAAATATTTAATCTCCTTGATTACATGACAGAAAGAAAATTTTTA
ACTCTCAAAAAAAGATGTGATAAATATTACTGTGTCTTAGAAAGAAACTAAATCCTTGAA
AAACTAAAAACTTAATTTGACTTAATTTTAAGCCTCCCTGATGAATAATTTTTAGATATC
TTCAAATATTTCTAAGTTGAATAATAAGAAAACAAGTAGTAAATAGAGTAGTAAGAGACT
ATAGAATAATTTAATGGAGTAGAAAAAATAGGCTAATAAAAGTAAAATTTCTAACTAGTT
ATCCGCCAAAATGGAGATTCCTCAAATTAAATGGGCAATAGTTGCGTTAGCACATGTAGA
CTTTCTTAAAGATGTTCTATATTTTCAAACTAAAATTTGGTTTAGTCAAAAAGAAATTCT
TTTTCAAGCTAAAACGAATAATAAGAATAATAATAAAATAAGCAATCAAGCTCTAATTCA
ATTGATACTCCATACGCCTAATAAAATTCATAAAAACTCCTTCTTAATTCTAAATAATAA
AAATATTTTTAAAAGAATGCCCCTAAAATACTACAAGTCGAGAATTAAATAGAGAAACTC
TTTTAACTAAAAACTCATAGAAAAGTTAATAATTTAATTGATGCTTAAGAAACCTACAGA
ATACCTTCAGATTGCCTTACCCAACAAACTCAAATGAATTAAATTTTACTAAGCAGTACT
AATAATTCAACTAATTCCAAAAATTAAAATGAAGCTAAGAAAAAAATCAATGCAAATAAA
CTAAAAAATTAAATACTAAAATAATAGTCTTTTAATGTTAATCATTAATAAGCTAAATCA
AATAGAATGTCTTTAAAATAACCAATAACCTTAACCGAAGAAGCTAAAGGAACATAATAC
AGCCAATGA