Identifiers and Description

Gene Model Identifier

TTHERM_00128810

Standard Name

PDP2 (PWWP Domain containing Protein 2)

Aliases

PreTt09445 | 9.m00466 | 3699.m00174

Description

PWWP domain containing protein; involved in chromatin or histone-related functions; localized within the macronucleus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_00128810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09193.19.997093137033517e-262hypothetical protein (862 aa)
OxytrichaContig836.1.g1420.000000005997038937208364PWWP domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000378

Sequences

>TTHERM_00128810(coding)
ATGGCAAGCAAGCAGTTCAAAAAGAACCAAGTAGTATGGGCAAAACTCAAAGGTTATCCA
TGGTGGCCATCATGCATATCACAAGTAGGGACCACAGATGTAGTAGTAAATTTCCTCGGC
GAAAACACACATGCCACTATCAAGCTAGATTAGGTCCATGACTTCAAAGAGAATTATAGC
TAGTACATAAAAAACGTGAATGAAAGAAATAAAAAGCTAAAATAGGCAGTAGATATCGGA
TTAAGGATCAGTGAGGGCAAAAGCAGTTACGAAGCGGCAATACCCTTTTTTGAACCCATC
CTATAGTCTTCTAGCTAATTTTCAAACGAGCGCAAAAGCATGGAGAGAAAATATCAAATG
GAGGAAGAAGAAGACGATGATAATTAATCTTCATCAGAAAGCGCAGCAAAGAATTCTAAA
AAGGCAAAGAAAGGAGCAGTGACAAACAAACTCAGTAATGAAATTAGCTTAAATAAAACA
GTTTCTACGACATCAACAGGTAAAAAGACCCCTAAAAAGGGCGTAAAACCAACTAGCAAA
AGCAGTACAAAAGCATCAGCAGAATCTGAAAGCAAAAATGGAGGAAATGACAAATTAGTT
CCTGAAAATGCTGGTGAACCCTCATTAGCAGCTTCAGAGAAAGAATTGGCAACAATAAAT
ACCCGTTCTACACAAGGCAAGAAATAATAAAAAATAAGTGAAAAGTAAACTCGTAGGAAT
TCATAAAATATGAATAAAAATTCAAGTAACAACAATGTAACCATTAACCCAGAATTTGGC
ATAGAAGAGCTAGTAGATACAGAGCCTAGTCATTTACTTAGTAATCCAATACATGAAAAG
GAAATGAACAGCACAGAGCAGCTTGCTTAATTCAACAAGAATGAAAATTCCATGGAAAAA
TCCTCAAGCAATCACATTAATGAATCTGAATAAAAAGAATTGGAAGAAGATCATTAAGAA
ATGAATTTAGAAAAGGCAACTAAAAAGAGCGCAGCTAGTGCAAATGGATCTCCAAGAAAT
GGGTTTGCTGAAGACAAAAGAGATATATACACAAATAATAGCAATGCACATAATAGCAGT
AGCAACAATCAGAATTAGTCATCAGACAGCAATTTACAGTCATAAAATGGCTAAAATAAT
TAATAAAAGAGCGCTTAAAATGGCCAATCTTAGTCAACAAATAAAAGAAACAAGCGTAGT
GTAGCTTAAAAAAATGGATCTGCAGCTGCAAATAACAATAACTTAAATATTTAAATTCCT
ACTGAAGCAGCTAATTAAAATGAAATTATTGATTCACCTAAAAAGAAACTCAAAACAAAT
TAAATCAAATCTTACAATACAAATCCTCAAGATGCAACAGAATTATAACAAAGTCTTGAA
GCCATTTTAGAAATATTTTAAAATTAAAAAAGTTCAAACATATTTAAACTCAGTGAGATT
AAAGACCTTGATCATTTGAGTGATGCTTACTTTAGTCTTAACATCCCTACAATGGAATTT
TTCAATACAAAAGTAGGCAAGTTATTTGTATAGCATCTTTAATTAGTTACTTAATACAAG
CATAGCGAAGACTTTATGCCAGAAATTAAATAAAAACTAGAAGTTGTTGTAGAGCATATT
AGAGATAAAATTTTGACTGAAACTTTAGGCTCTGAAATAAAGGAATTAATATTCAAGAAA
AAAGTGTAAATAAATGGAAACTGTGTCATATAAAACGAAGTAGAAGATGAAAAGAGCATT
CATTCAAACACTCAATTAAACAAACAAATTACAAGTCATACAAAGTTAAATGGAGACCTA
GTGGTAGGTTAAGAAAAAGAAGCAGAAGACCCTAAGAAATTAAGAGATTAGCAACTTAGA
AAAAAGATCTGCAAGAAAATCAATGAACTTCTCAAAGAAAATTATGGTTTAGAAAAGGCA
TAAGCTTAGGATTTATGTGTTTAAATAGAAAGAAAAATAAAATCTGTATAAGTAGAACTA
AATCATGACTATAAAAATAATGTAAAGGGATTAATCCGTCTGTTAAAGGCCAAGGAAATA
AGCATAGATAAATTACAAAAGTGTAATGTAGACGAGCTTATTTAGGTAATCTAACATGAA
AATATATAAGCAGAATTAAAAAGCTTAGGTGTTCCTCAATTCGAAAAGAACTCCTCCCTT
GCAAACAACAGTGATTGA


>TTHERM_00128810(protein)
MASKQFKKNQVVWAKLKGYPWWPSCISQVGTTDVVVNFLGENTHATIKLDQVHDFKENYS
QYIKNVNERNKKLKQAVDIGLRISEGKSSYEAAIPFFEPILQSSSQFSNERKSMERKYQM
EEEEDDDNQSSSESAAKNSKKAKKGAVTNKLSNEISLNKTVSTTSTGKKTPKKGVKPTSK
SSTKASAESESKNGGNDKLVPENAGEPSLAASEKELATINTRSTQGKKQQKISEKQTRRN
SQNMNKNSSNNNVTINPEFGIEELVDTEPSHLLSNPIHEKEMNSTEQLAQFNKNENSMEK
SSSNHINESEQKELEEDHQEMNLEKATKKSAASANGSPRNGFAEDKRDIYTNNSNAHNSS
SNNQNQSSDSNLQSQNGQNNQQKSAQNGQSQSTNKRNKRSVAQKNGSAAANNNNLNIQIP
TEAANQNEIIDSPKKKLKTNQIKSYNTNPQDATELQQSLEAILEIFQNQKSSNIFKLSEI
KDLDHLSDAYFSLNIPTMEFFNTKVGKLFVQHLQLVTQYKHSEDFMPEIKQKLEVVVEHI
RDKILTETLGSEIKELIFKKKVQINGNCVIQNEVEDEKSIHSNTQLNKQITSHTKLNGDL
VVGQEKEAEDPKKLRDQQLRKKICKKINELLKENYGLEKAQAQDLCVQIERKIKSVQVEL
NHDYKNNVKGLIRLLKAKEISIDKLQKCNVDELIQVIQHENIQAELKSLGVPQFEKNSSL
ANNSD


>TTHERM_00128810(gene)
ATGGCAAGCAAGCAGTTCAAAAAGAACCAAGTAGTATGGGCAAAACTCAAAGGTTATCCA
TGGTGGCCATCATGCGTAATTAATCGCACTTTCATTTTATTAGCACTTTAAAGATTAGCT
AGCAAGATTCATTGCAACCACTCATATTTTCAGATGGGGGATAGAAGATCAAAATTCTTT
TCTGCCCAATCTGTATATATGGATGAATGGATATATGCGTGCAGAATAATAAGCAGAATT
TAAATAAATGTGAAACAATTCACTTATTCACTTTATATTTAATAGATATCACAAGTAGGG
ACCACAGATGTAGTAGTAAATTTCCTCGGCGAAAACACACAGTAATTATTTTACCTTTTA
GCGAACCTGCTTCTTTTTCCTTTTTTACAAATTTGCAAGCTAATGTTTTTAAATAATTTT
TTAACTTGTGGGACGTAAACAGTGCCACTATCAAGCTAGATTAGGTCCATGACTTCAAAG
AGAATTATAGCTAGTACATAAAAAACGTGAATGAAAGAAATAAAAAGCTAAAATAGGCAG
TAGATATCGGATTAAGGATCAGTGAGGGCAAAAGCAGTTACGAAGGTAAAAATTTACTAA
TTATTCTCTTCTGTATTATCTTCAAATTTAAATTATTTTTTTCAGCGGCAATACCCTTTT
TTGAACCCATCCTATAGTCTTCTAGCTAATTTTCAAGTAGATCTTATTAAAGTTAGATAA
AAAGGCACAAAAGACGCCATTTATTTTTGTTATTATGCCACTCTTCGCAAAATTTCATAC
AAATCTCGAATTTTTTACCAATTAATTGATTTTGCCAAGCAGCACATAATATAGTCTTTA
ATCTTTTGATGATATATCTTTTGTTAACCAGAATAAACTCATTAATATTTTTAAATAAAA
TTAGACGAGCGCAAAAGCATGGAGAGAAAATATCAAATGGTAATTTTACATAGAATTATT
AGATTTGGATTTATGTTTAGGCATTTATCCTTCCATAAGCGCATTTTGCCAAATTGCATT
AGCTAACCGTATTCTTTATTTAAAGGAGGAAGAAGAAGACGATGATAATTAATCTTCATC
AGAAAGCGCAGCAAAGAATTCTAAAAAGGCAAAGAAAGGAGCAGTGACAAACAAACTCAG
TAATGAAATTAGCTTAAGTACATTAAAAAAATATTTTACCTTAAATTTAATCAGTCGTCT
ATCTATCTATCAATCAGTTTACTTGCATTAATAATTAACAAGCTAAAAAAAAGAATTTTA
GACATAATAGAAAAATTATAAATAAATTTTAAAGTTATAGTTTGTTTACTTATCTATTTA
AACCAAGAAGGACTGATTATTTTGAGTTTAATCCATATTGAAATACCATATTAAGTTCTA
AATAGCTTTTGAAAAAAACTATTTTTTTGCAACTTGACTAGTTAAATCAATATTTTTAAC
GCTCAAATTGAATTCTAGTTGCTTTATTTATTAACATTTATTTAAAATAATAAAGATAAA
ACAGTTTCTACGACATCAACAGGTAAAAAGACCCCTAAAAAGGGCGTAAAACCAACTAGC
AAAAGCAGTACAAAAGCATCAGCAGAATCTGAAAGCAAAAATGGAGGAAATGACAAATTA
GTTCCTGAAAATGCTGGTGAACCCTCATTAGCAGCTTCAGAGAAAGAATTGGCAACAATA
AATACCCGTTCTACACAAGGCAAGAAATAATAAAAAATAAGTGAAAAGTAAACTCGTAGG
AATTCATAAAATATGAATAAAAATTCAAGTAACAACAATGTAACCATTAACCCAGAATTT
GGCATAGAAGAGCTAGTAGATACAGAGCCTAGTCATTTACTTAGTAATCCAATACATGAA
AAGGAAATGAACAGCACAGAGCAGCTTGCTTAATTCAACAAGAATGAAAATTCCATGGAA
AAATCCTCAAGCAATCACATTAATGTAAACACAATCAAGCAAAAAATTCAAATTTTCCAG
CAAGCAAATAAAAAATCAAGCAAAAAAACAAAAATAAATAAATAAATATTTTAATAATTG
GCTACTTTTTTATATAGGATGAGAGCCTATATATTTATTTATTTATTAATGATTATTCAA
TTTTTATTTACTAAAAAAGTAGAAATAATTCATAAATTTAATTAATTAATTATTATAATA
GGAATCTGAATAAAAAGAATTGGAAGAAGATCATTAAGAAATGAATTTAGAAAAGGCAAC
TAAAAAGAGCGCAGCTAGTGCAAATGGATCTCCAAGAAATGGGTTTGCTGAAGACAAAAG
AGATATATACACAAATAATAGCAATGCACATAATAGCAGTAGCAACAATCAGAATTAGTC
ATCAGACAGCAATTTACAGTCATAAAATGGCTAAAATAATTAATAAAAGAGCGCTTAAAA
TGGCCAATCTTAGTCAACAAATAAAAGAAACAAGCGTAGTGTAGCTTAAAAAAATGGATC
TGCAGCTGCAAATAACAATAACTTAAATATTTAAATTCCTACTGAAGCAGCTAATTAAAA
TGAAATTATTGATTCACCTAAAAAGAAACTCAAAACAAATTAAATCAAATCTTACAATAC
AAATCCTCAAGATGCAACAGAATTATAACAAAGTCTTGAAGCCATTTTAGAAATATTTTA
AAATTAAAAAAGTTCAAACATATTTAAACTCAGTGAGATTAAAGACCTTGATCATTTGAG
TGATGCTTACTTTAGTCTTAACATCCCTACAATGGAATTTTTCAATACAAAAGTAGGCAA
GTTATTTGTATAGCATCTTTAATTAGTTACTTAATACAAGCATGTAAATTTTATTAAATT
TATTTTTTAAAATGTGTTAAATTTTCTTTTGGATGTACTTTATTTAGAGCGAAGACTTTA
TGCCAGAAATTAAATAAAAACTAGAAGTTGTTGTAGAGCATATTAGAGATAAAATTTTGA
CTGAAACTTTAGGCTCTGAAATAAAGGAATTAATATTCAAGAAAAAAGTGTAAATAAATG
GAAGTAAAAATATTTATTTTTTTCATTAAATTTTTTCTCTAACAGATTTTTTATAATAAA
TATAAATAGACTGTGTCATATAAAACGAAGTAGAAGATGAAAAGAGCATTCATTCAAACA
CTCAATTAAACAAACAAATTACAAGTCATACAAAGTTAAATGGAGACCTAGTGGTAGGTT
AAGAAAAAGAAGCAGAAGACCCTAAGAAATTAAGAGATTAGCAACTTAGAAAAAAGATCT
GCAAGAAAATCAATGAACTTCTCAAAGAAAATTATGGTTTAGAAAAGGCATAAGCTTAGG
ATTTATGTGTTTAAATAGAAAGAAAAATAAAATCTGTATAAGTAGAACTAAATCATGACT
ATAAAAATAATGTAAAGGGATTAATCCGTCTGTTAAAGGTAAATTTGACTTTTTACTGAA
TTTTTTCTTGAATTTTAATGATATTTTTTGATAACTACTAGGCCAAGGAAATAAGCATAG
ATAAATTACAAAAGTGTAATGTAGACGAGCTTATTTAGGTAATCTAACATGAAAATATAT
AAGCAGAATTAAAAAGCTTAGGTGTTCCTCAATTCGAAAAGAACTCCTCCCTTGCAAACA
ACAGTGATTGA