Identifiers and Description

Gene Model Identifier

TTHERM_00475140

Standard Name

PDI1 (Protein Disulfide-Isomerase)

Aliases

PreTt02313 | 57.m00252 | 3709.m00112

Description

protein disulfide-isomerase domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 80.4%

TetraMine Data

TTHERM_00475140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13191.19.997093137033517e-262protein disulfide-isomerase do
main-containing protein (485 a
a)
OxytrichaContig9681.0.g595.997731685152085e-122Thioredoxin
WormBaseWBGene000039631.0000198575659891e-106locus:pdi-2 Protein disulfid
e-isomerase 2 status:Confirm
ed UniProt:Q17770 protein_
id:CCD63277.1
DictyBaseDDB_G02914347.000472351131044e-82pdi2 on chromosome: 6 position
299936 to 301894
SGDYCL043C9.997863464222902e-69PDI1 Protein disulfide isomera
se; multifunctional protein re
sident in the endoplasmic reti
culum lumen, essential for the
formation of disulfide bonds
in secretory and cell-surface
proteins, unscrambles non-nati
ve disulfide bonds; forms a co
mplex with Mnl1p that has exom
annosidase activity, processin
g unfolded protein-bound Man8G
lcNAc2 oligosaccharides to Man
7GlcNAc2 which promotes degrad
ation in the unfolded protein
response
Stentor CoeruleusSteCoe_350597.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475140(coding)
ATGAACAAGACTTTGCTTTTGTTAACTATTTTGGCTGTCGGTGCTTTGGCTTCCACTGCC
CCTGCTGTCGAAGAAGGTGTCTATGTCTTAACTGACTCCAACTTCAACGAATTCATTGCC
TCCAAGCCTTTTGTTTTGGTTGAATTCTACGCCCCTTGGTGTGGTCACTGCAAGAAGCTC
GCCCCCGAATATGCTAAGGCTGCTTAAGCTTTAGCCAGTGAAAACTCCTAAGCTGTTCTC
GCTAAGGTTGATGCCACTGAATAAAAGGACCTCGGTACTAGATTCTCCATCCAAGGTTTC
CCTACCTTGAAGTTCTTCATCAACGGTTCCACTGAAAACCCTGTTGACTTCAATGGTGGT
AGAACTGAAAAGGACATCCTTAACTGGATCAAGAAGAGAACCGGTTCCGTTTCTGAAGCT
CTTAACACTGCTGAAGAATTAACCGCCTTCACTCAAAAGAACCAAGTCGCCATCGTTTAT
TTCGGTGAAAGTGAAAAGGATGCCAACTACGAAGCCTTCAAGTCTTTGGCTATGTCTTAT
GATGACCTCGCCTTCGCTCACGTTTTCAACGCTGACTTGAGAACTGCTTAAAACGCTGCT
GCTCACAACCTCGTCCTCTACAAGCACTTCGATGAAAAGAGAAACGACTTCACTGGTACC
TTCAACGTTGCTAACTTAAAGACTTTCGTTGACACCAACTCTTTCCCCATCGTTATGCCC
TTCAACGACAGAGCCATCCAAAAGGTCTTCTAACAAGGTAACCCCACTTTGTTCCTTTTC
TCCAACAGCAACGAAGCTTCCCTTGCTGCTGAAAAGGCTTTCGCTGCTTCTGCTGAAGAA
AACAGAGGTAAGATCGTCTTCTCTATCTCCAAGCCTGATGACACCTTCGGTCACTACTAA
AAACTCGCTGACTACATCGGTGTTAACACTGCTTAAGTCCCCGCTTTAATGCTCGTTCAC
TCCAGCCACGAAGTTCTTAAGTACAAGTTCACTGCTTCTGAAATCACCCATGCCACCATT
AACTAATTCGTTAGTGACTACCTTGCTGGTAAGCTCTCAACTTACTTGAAGTCTGAAGAT
ATCCCTGCCACCAACGACGAACCCGTCAAGGTCCTCGTCGGCAAGAGTTTCGATGACCTC
GTCATTAACAGCAACAAGGATGTCTTAGTTGAATTCTACGCTCCCTGGTGCGGTCACTGC
AAGCAACTTGCTCCCATCTATGATGCCGTTGCCAAGAAGCTCTCCCACAACCACAACATC
GTCATCGCTAAGATCGATTCCACCGCTAACGAAGTTCCCGGAGTCAATATTAGAGGTTTC
CCCACCATTAAGTTCTATCAAAACGGTAAGAAATCTACTCCTCTTGATTTCGAAGGTGAC
AGAACTGAAGAAGGTATCCTCAAGTACCTCAAGGAAAAGACCACCTTCCCTTGGGTTGAA
AAGAACGAAGATCTCTGA


>TTHERM_00475140(protein)
MNKTLLLLTILAVGALASTAPAVEEGVYVLTDSNFNEFIASKPFVLVEFYAPWCGHCKKL
APEYAKAAQALASENSQAVLAKVDATEQKDLGTRFSIQGFPTLKFFINGSTENPVDFNGG
RTEKDILNWIKKRTGSVSEALNTAEELTAFTQKNQVAIVYFGESEKDANYEAFKSLAMSY
DDLAFAHVFNADLRTAQNAAAHNLVLYKHFDEKRNDFTGTFNVANLKTFVDTNSFPIVMP
FNDRAIQKVFQQGNPTLFLFSNSNEASLAAEKAFAASAEENRGKIVFSISKPDDTFGHYQ
KLADYIGVNTAQVPALMLVHSSHEVLKYKFTASEITHATINQFVSDYLAGKLSTYLKSED
IPATNDEPVKVLVGKSFDDLVINSNKDVLVEFYAPWCGHCKQLAPIYDAVAKKLSHNHNI
VIAKIDSTANEVPGVNIRGFPTIKFYQNGKKSTPLDFEGDRTEEGILKYLKEKTTFPWVE
KNEDL


>TTHERM_00475140(gene)
ATGAACAAGACTTTGCTTTTGTTAACTATTTTGGCTGTCGGTGCTTTGGCTTCCACTGCC
CCTGCTGTCGAAGAAGGTGTCTATGTCTTAACTGACTCCAACTTCAACGAATTCATTGCC
TCCAAGCCTTTTGTTTTGGTTGAATTCTACGCCCCTTGGTGTGGTCACTGCAAGAAGCTC
GCCCCCGAATATGCTAAGGCTGCTTAAGCTTTAGCCAGTGAAAACTCCTAAGCTGTTCTC
GCTAAGGTTGATGCCACTGAATAAAAGGACCTCGGTACTAGATTCTCCATCCAAGGTTTC
CCTACCTTGAAGTTCTTCATCAACGGTTCCACTGAAAACCCTGTTGACTTCAATGGTGGT
AGAACTGAAAAGGACATCCTTAACTGGATCAAGAAGAGAACCGGTTCCGTTTCTGAAGCT
CTTAACACTGCTGAAGAATTAACCGCCTTCACTCAAAAGAACCAAGTCGCCATCGTTTAT
TTCGGTAAGCATATTTTATTTTTATCGTTTAGATGCAAACAATAAAGAGTATTTATAAAC
AAACGAATGGCTATCATATCAAATTTTTGTCTAATGGAAATCAGCATTCCATTAAGATAA
GTTAACTAACTCCCAAGAAAATTAATACATTAAATAGACTGCAAATAATTTTAATGTAGT
AACAAACTTTAAAGGATTATGAAAGCCATATAGGATAGCAGAGAAGTTACATGAAAGAAT
ATCATGAATGGAAGCCTTACAAATAATATAAAAGTTAGCTCCATAAAATTCCTATTCTGT
TATTTAAGAAAAAAAAAATAATTAGATGCAAAGCACTAACAAACAAATGAAATTATATAC
AGATTAAATACAATCAAGAGCAACTCATATAAAAATAAGCCTTTTTTAAGATGTTTCATC
AAAGCTTTTAAAGTTCTTGTTGACGTCAAAAAAAAAAAATTAAATTTTAAAAAATTTAAA
AAATATATTTTTCAAATAAAAAATACTAACACTAGCTAAATTGATAGTCATTCATTCATT
TATTCATTCATTATTAATAGAACATACTTCCACATAAATAACCAATAAGCCATCAAAAAA
TTTTATAATACTTAACCTAGAAAGAATGATAAGCCATTAATATTCAGTCATTAATTAATT
TGTTTTTAATCATTAGGTGAAAGTGAAAAGGATGCCAACTACGAAGCCTTCAAGTCTTTG
GCTATGTCTTATGATGACCTCGCCTTCGCTCACGTTTTCAACGCTGACTTGAGAACTGCT
TAAAACGCTGCTGCTCACAACCTCGTCCTCTACAAGCACTTCGATGAAAAGAGAAACGAC
TTCACTGGTACCTTCAACGTTGCTAACTTAAAGACTTTCGTTGACACCAACTCTTTCCCC
ATCGTTATGCCCTTCAACGACAGAGCCATCCAAAAGGTCTTCTAACAAGGTAACCCCACT
TTGTTCCTTTTCTCCAACAGCAACGAAGCTTCCCTTGCTGCTGAAAAGGCTTTCGCTGCT
TCTGCTGAAGAAAACAGAGGTAAGATCGTCTTCTCTATCTCCAAGCCTGATGACACCTTC
GGTCACTACTAAAAACTCGCTGACTACATCGGTGTTAACACTGCTTAAGTCCCCGCTTTA
ATGCTCGTTCACTCCAGCCACGAAGTTCTTAAGTACAAGTTCACTGCTTCTGAAATCACC
CATGCCACCATTAACTAATTCGTTAGTGACTACCTTGCTGGTAAGCTCTCAACTTACTTG
AAGTCTGAAGATATCCCTGCCACCAACGACGAACCCGTCAAGGTCCTCGTCGGCAAGAGT
TTCGATGACCTCGTCATTAACAGCAACAAGGATGTCTTAGTTGAATTCTACGCTCCCTGG
TGCGGTCACTGCAAGCAACTTGCTCCCATCTATGATGCCGTTGCCAAGAAGCTCTCCCAC
AACCACAACATCGTCATCGCTAAGATCGATTCCACCGCTAACGAAGTTCCCGGAGTCAAT
ATTAGAGGTTTCCCCACCATTAAGTTCTATCAAAACGGTAAGAAATCTACTCCTCTTGAT
TTCGAAGGTGACAGAACTGAAGAAGGTATCCTCAAGTACCTCAAGGAAAAGACCACGTAA
ATAACATTTTATACAAAATTTTATTCAAAAGTTATTGATTGTAAAGAAATCATATCTAAA
TATATTTTTTTTTAATTTATAGCTTCCCTTGGGTTGAAAAGAACGAAGATCTCTGA