Identifiers and Description

Gene Model Identifier

TTHERM_00283530

Standard Name

PDD2 (Programmed DNA Degradation)

Aliases

PreTt04892 | 25.m00356 | 3694.m00139

Description

Programmed DNA degradation 2 protein; novel, developmentally regulated protein that localizes in DNA elimination structures; required for successful DNA elimination; binds Pdd1p; null mutant inviable

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00283530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08997.17.999597868332553e-175hypothetical protein (340 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10805754: Nikiforov MA, Gorovsky MA, Allis CD (2000) A novel chromodomain protein, pdd3p, associates with internal eliminated sequences during macronuclear development in Tetrahymena thermophila. Molecular and cellular biology 20(11):4128-34
  2. Ref:10557212: Nikiforov MA, Smothers JF, Gorovsky MA, Allis CD (1999) Excision of micronuclear-specific DNA requires parental expression of pdd2p and occurs independently from DNA replication in Tetrahymena thermophila. Genes & development 13(21):2852-62
  3. Ref:9409671: Smothers JF, Mizzen CA, Tubbert MM, Cook RG, Allis CD (1997) Pdd1p associates with germline-restricted chromatin and a second novel anlagen-enriched protein in developmentally programmed DNA elimination structures. Development (Cambridge, England) 124(22):4537-45

Sequences

>TTHERM_00283530(coding)
ATGATTTCAAACAAAGATATGAAAGCTGACTTGAAAAAAATCTAGCAATCGCTTGAAGAA
ATTGAAAGAAAAATGGACTTACTTAAAGATAAGAAAAGAGTACTTCTAAAAACTAAATAA
AAAATTGTAGATATTTATCGCTAAGAATTTAAATCTGGCTAAGCTAAATAAGAAAAAGTT
ATCTAAAAACCATCTCACAAGGATGATCAAGGGTAATCAGCTGATGATAATCCTGATAAA
TATATTTTTAAATCTGGCAGAAGACTTTACACAGATGCATACAAAAATTATATCGTGAAA
CTTTGCGAAATTTATAATCTGAAATCTATTGAAAAATATGCTAACGTTCTTTATACTAAC
ATTATTAGATGGAGGATAGAAATGCAAAGAGGCCAAATTCCAATTGATGATAGCTATAAA
CCTAATGAAGCAGAAATTCAATAGCTAAAATAAATGGAAAAGTATGCTGACAAACATGAT
TATGACTATGAAATGAAAAAATAAATGAAATAATATGAGTAATAGAAGATGGATTAGGAA
TTAGATGATAACAAAATGTCTTCTACTAACTCAAATGATATGCAAGAAGAATATTAAGTT
AAAAACTAGCAGAATATATATAATAAAATGTATAGTGAAGACACTTTTAACTAAAAACTA
AGAAATAGTGTAAAATAATATTAAGAAGATACCTTCGCCTCTTCAAACGAGTGCTCACCA
GATGGAAACAAGCAAAACAATCAAGAATAACCTTATTTACCTAATGGTTTTAACCTTGAT
AAAGTACTTGAAGTAAATCCAAATTTCAACTCGCCTTGGTACACTAAGTTTGAATCACAG
CTAGTAAAATCTATATTTAATTCTCAAGAGCCTGTTAATCAAAGATCAATAATGGCTGCT
GCCAAGCACCTCAGAAAGAGCCTAGATATTCCAGAATAGGATCTGAAATTCACTAAAGAA
TGGTATTATGATCTGCTTGCTCGTAGAAATATTCAAAGTTCTTAATGA


>TTHERM_00283530(protein)
MISNKDMKADLKKIQQSLEEIERKMDLLKDKKRVLLKTKQKIVDIYRQEFKSGQAKQEKV
IQKPSHKDDQGQSADDNPDKYIFKSGRRLYTDAYKNYIVKLCEIYNLKSIEKYANVLYTN
IIRWRIEMQRGQIPIDDSYKPNEAEIQQLKQMEKYADKHDYDYEMKKQMKQYEQQKMDQE
LDDNKMSSTNSNDMQEEYQVKNQQNIYNKMYSEDTFNQKLRNSVKQYQEDTFASSNECSP
DGNKQNNQEQPYLPNGFNLDKVLEVNPNFNSPWYTKFESQLVKSIFNSQEPVNQRSIMAA
AKHLRKSLDIPEQDLKFTKEWYYDLLARRNIQSSQ


>TTHERM_00283530(gene)
TAAAAAATATTTTCAAAACAAATTAAAATTCTTAAAAAAAGATCAAAAAATCTATCAAAA
ATTATAATTTCTGATTAATACACATAGAAAACCAATATGATTTCAAACAAAGATATGAAA
GCTGACTTGAAAAAAATCTAGCAATCGCTTGAAGAAATTGAAAGAAAAATGGACTTACTT
AAAGATAAGAAAAGAGTACTTCTAAAAACTAAATAAAAAATTGTAGATATTTATCGCTAA
GAATTTAAATCTGGCTAAGCTAAATAAGAAAAAGTTATCTAAAAACCATCTCACAAGGAT
GATCAAGGGTAATCAGCTGATGATAATCCTGATAAATATATTTTTAAATCTGGCAGAAGA
CTTTACACAGATGCATACAAAAATTATATCGTGAAACTTTGCGAAATTTATAATCTGAAA
TCTATTGAAAAATATGCTAACGTTCTTTATACTAACATTATTAGATGGAGGATAGAAATG
CAAAGAGTAAAAATTTTTCTTTTTCATATTTTAGATAATTAATTTTTACTATTTTTTAGT
TTAATTTTAATTAAATTTACTCAATTTGGCTAATTATTAGTTACAATTATAACATCAATT
TTTATGAGCAAAAATTCACTAAGATTATTAAAGCAATAAAATTGTATTTAACAAATTTTT
TAATTTCCAAGCATTGCCAAAGTTAACAAATTAATAAAATATTTTCAAAATTTTAATGAG
TTAATATCAATTTAACTTTATTTATCATTCATAATTTAAATTATTATTGAAATAAAATAA
CTCTTACTTAAATAAATCAAATTTAGTCAATTTCAAAGTTATATTTAAAATCAAATTAAA
CATTTCTAATAAATCTATTTTAATAAATAATAAAGGGCCAAATTCCAATTGATGATAGCT
ATAAACCTAATGAAGCAGAAATTCAATAGCTAAAATAAATGGAAAAGTATGCTGACAAAC
ATGATTATGACTATGAAATGAAAAAATAAATGAAATAATATGAGTAATAGAAGATGGATT
AGGAATTAGATGATAACAAAATGTCTTCTACTAACTCAAATGATATGCAAGAAGAATATT
AAGTTAAAAACTAGCAGAATATATATAATAAAATGTATAGTGAAGACACTTTTAACTAAA
AACTAAGAAATAGTGTAAAATAATATTAAGAAGATACCTTCGCCTCTTCAAACGAGTGCT
CACCAGATGGAAACAAGCAAAACAATCAAGAATAACCTTATTTACCTAATGGTTTTAACC
TTGATAAAGTACTTGAAGTAAATCCAAATTTCAACTCGCCTTGGTACACTAAGTTTGAAT
CACAGCTAGTAAAATCTATATTTAATTCTCAAGAGCCTGTTAATCAAAGATCAATAATGG
CTGCTGCCAAGCACCTCAGAAAGAGCCTAGATATTCCAGAATAGGATCTGAAATTCACTA
AAGAATGGTATTATGATCTGCTTGCTCGTAGAAATATTCAAAGTTCTTAATGA