Identifiers and Description

Gene Model Identifier

TTHERM_00193230

Standard Name

PDA1 (Pyruvate Dehydrogenase Alpha 1)

Aliases

PreTt06606 | 16.m00262

Description

Pyruvate dehydrogenase complex E1 component; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (IEA) | GO:0016624

Biological Process

Domains

  • ( PF00676 ) Dehydrogenase E1 component
  • ( PF02775 ) Thiamine pyrophosphate enzyme, C-terminal TPP
  • ( TIGR03181 ) pyruvate dehydrogenase (acetyl-transferring) E1 component,
  • ( TIGR03182 ) pyruvate dehydrogenase (acetyl-transferring) E1 component,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00193230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03605.19.997093137033517e-262pyruvate dehydrogenase E1 comp
onent (388 aa)
OxytrichaContig9079.0.0.g832.998923500611476e-144Dehydrogenase E1 component
DictyBaseDDB_G02929949.995516318087232e-125pdhA on chromosome: 6 position
2563001 to 2564757
WormBaseWBGene000115101.000211181581171e-120locus:pdha-1 Probable pyruva
te dehydrogenase E1 component
subunit alpha, mitochondrial
status:Confirmed UniProt:P5
2899 protein_id:CAA87793.1
SGDYER178W1.0001900614163146e-108PDA1 E1 alpha subunit of the p
yruvate dehydrogenase (PDH) co
mplex, catalyzes the direct ox
idative decarboxylation of pyr
uvate to acetyl-CoA; phosphory
lated; regulated by glucose
Stentor CoeruleusSteCoe_78511.7785284761271306e-68

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000165

Sequences

>TTHERM_00193230(coding)
ATGAGGTACTAAAGAGTATAATTATTCCTTGCTCAAATCAAAAGAAAGGAAAGAAAGAAA
GAAGAAAAGAAAGAAAAAAAATAAAAATAAAATACAAATAAATAAAATAATCATCAAAAA
GCTAAACTAATGATATCTAAGTTCTTCAATCCTGTTGCTGGTAAGACCTTCAACAGACTT
AACAAGTATGCCTTCTCTTCAGTCACTATTAACCTTGAAGGATACTAGACTAAGATGTTA
GACGGATTCAAATTGCCCACCTAATCAACTGCTACCAAGGAAGAATTATTGAAGCTCTAC
AAAGATATGAACGTTATGAGAAAGATCGAACTTGCATGCGATAAGCTTTATAAGCAAAGA
GAAATTAGAGGTTTCTGCCATCTCTACGACGGTTAAGAAGCTGTTATCTCAGGTATTGAA
GCTGCTTGCAATCTTGAGGATGCAATAATCACTGCCTATAGATGCCATTGTCACGCTTAC
ACAAGAGGTGACACTCCCCATTAAATTATTGCTGAACTTATGGGAAGAAAGACTGGTTCT
ACAGGTGGTAAGGGTGGTTCTATGCACTTCTACAGAAAGAAAACTCACTTCTATGGTGGT
CACGGTATTGTCGGTGCTCAAGTTCCCATGGGTGCTGGATTAGCCTTTGCTTTGAAATAT
GAAAAGAAGCCCAACGTTTCTATCACTATGTACGGTGACGGTGCTGCCAATCAAGGTTAA
ATTGCTGAAGCTGCCAACATGGCTGGTTTATGGAATTTACCATGCTTGTTTGTTTGTGAA
AACAATCTTTACGGTATGGGTACCTCTACTGCAAGAGCTTCTCACAATACTGATTTCTAC
ACCAGAGGTGACAAGATTCCTGGTATCAGAATGGACGGTAATAACTATTTCCATGTTAAG
GAAGGTTTCAAGTTTGCTAAGCAATATGCCTTAGAACATGGTCCTCTCTTCATTGAATTG
AGAACTTACAGATATCACGGTCACTCTATGTCTGACTCCGGTACTACTTATAGAACTCAA
GAAGAAATCAAAGAATTCAGATAAAAGAAGGATTGCATATAATTTATTGCTAATACCATT
TTATAAAATAACTTTGCTACTCAAGAATAACTCGAAGCTATCCAAGATGAAACTAGAGAA
ATTGTTGATAAAGCCGTTGAACAAGCTCTTAAAGACCCATTACCTGATGATCACGAATTG
TGCACCGATGTTTACATTAACAACGATAAATACTACATCAGAGGTATTGAATACGAATAA
GGTTACTTCCCTGAAGGCAAGCCCTACTGA


>TTHERM_00193230(protein)
MRYQRVQLFLAQIKRKERKKEEKKEKKQKQNTNKQNNHQKAKLMISKFFNPVAGKTFNRL
NKYAFSSVTINLEGYQTKMLDGFKLPTQSTATKEELLKLYKDMNVMRKIELACDKLYKQR
EIRGFCHLYDGQEAVISGIEAACNLEDAIITAYRCHCHAYTRGDTPHQIIAELMGRKTGS
TGGKGGSMHFYRKKTHFYGGHGIVGAQVPMGAGLAFALKYEKKPNVSITMYGDGAANQGQ
IAEAANMAGLWNLPCLFVCENNLYGMGTSTARASHNTDFYTRGDKIPGIRMDGNNYFHVK
EGFKFAKQYALEHGPLFIELRTYRYHGHSMSDSGTTYRTQEEIKEFRQKKDCIQFIANTI
LQNNFATQEQLEAIQDETREIVDKAVEQALKDPLPDDHELCTDVYINNDKYYIRGIEYEQ
GYFPEGKPY


>TTHERM_00193230(gene)
ATGAGGTACTAAAGAGTATAATTATTCCTTGCTCAAATCAAAAGAAAGGAAAGAAAGAAA
GAAGAAAAGAAAGAAAAAAAATAAAAATAAAATACAAATAAATAAAATAATCATCAAAAA
GCTAAACTAATGATATCTAAGTTCTTCAATCCTGTTGCTGGTAAGACCTTCAACAGACTT
AACAAGTATGCCTTCTCTTCAGTCACTATTAACCTTGTAATTCAATTATTTATTTAATCT
TTTGCTAAGAATATAAATTTAGATAGAAATAGTTTATATTTTTCATTTTTTGACAGAATA
ACTAACTAACTCTCCAATGTTCGAATATTTGATTATATGGCGATAACTACTAAAATATTT
CAAATTCTTGCAAACATTCAACAAAAAAGCTTATAAACTTTAATTTAAATTTACAAAATA
TTTAAGAAAAATAACTTAAATATGATACCAAGCATTTCTTTAGTTAAATATTGCAGTATC
CCACGAATATCCTTATTGTCTAATTTCTGTTTTAAGAAATCTATTTCTACCTAATTATTT
AGCAATCCTAAAACAAAAAAATAGAAAAAAATGATTGCAACTAGAATTTAAATGAAATAA
ATAGTGCTTAACAACCCTTACTTAATCTGATTTTTTTATGAATGATATATGATAGGAAGG
ATACTAGACTAAGATGTTAGACGGATTCAAATTGCCCACCTAATCAACTGCTACCAAGGA
AGAATTATTGAAGCTCTACAAAGATATGAACGTTATGAGAAAGATCGAACTTGCATGCGA
TAAGCTTTATAAGCAAAGAGAAATTAGAGGTTTCTGCCATCTCTACGACGGTTAAGTAAA
TATCATATCATCAATTTTCTTATTATATAGCAAGTTTTTTACATTGACAAGATAACATAA
TGAGATCAATAGTATGACTTTTTAAATTTATAATAAAATATCTTTTAAAAATAATAGGAA
GCTGTTATCTCAGGTATTGAAGCTGCTTGCAATCTTGAGGATGCAATAATCACTGCCTAT
AGATGCCATTGTCACGCTTACACAAGAGGTGACACTCCCCATTAAATTATTGCTGAACTT
ATGGGAAGAAAGACTGGTTCTACAGGTGGTAAGGGTGGTTCTATGCACTTCTACAGAAAG
AAAACTCACTTCTATGGTGGTCACGGTATTGTCGGTGCTCAAGTAAAAATAATTTTCTAA
TTTATTATTTATTTTTCAGATATCATTTTTTCAGTTGTTAATTTAATTGAATAAAGGGAC
ATGGTTTTTTTTTTAAAAAAGTAAGTATCTTTATTCAAAAAATAAAAAATTAATTAAAAA
AAATAAAATTATATCAAAGACCTAGCTTTAATTAATATTCTTAATTTAACAATTTTTTTA
AAAAAAGGTTCCCATGGGTGCTGGATTAGCCTTTGCTTTGAAATATGAAAAGAAGCCCAA
CGTTTCTATCACTATGTACGGTGACGGTGCTGCCAATCAAGGTTAAATTGCTGAAGCTGC
CAACATGGCTGGTTTATGGAATTTACCATGCTTGTTTGTTTGTGAAAACAATCTTTACGG
TATGGGTACCTCTACTGCAAGAGCTTCTCACAATACTGATTTCTACACCAGAGGTGACAA
GATTCCTGGTATCAGAGTAATCAAAATCAAATAAAAATATAAAAGTTGTGTCTAAATAAT
TTTTTAAATCAATAAAAGATGGACGGTAATAACTATTTCCATGTTAAGGAAGGTTTCAAG
TTTGCTAAGCAATATGCCTTAGAACATGGTCCTCTCTTCATTGAATTGAGAACTTACAGA
TATCACGGTCACTCTATGTCTGACTCCGGTACTACTTATAGAACTCAAGAAGAAATCAAA
GAATTCAGATAAAAGAAGGATTGCATATAATTTATTGCTAATACCATTTTATAAAATAAC
TTTGCTACTCAAGAATAACTCGAAGTGATAATTTTAAATTACATTTTTAATAGAAATTAA
AACTTTATTTTTCTCAAAATTAGGCTATCCAAGATGAAACTAGAGAAATTGTTGATAAAG
CCGTTGAACAAGCTCTTAAAGACCCATTACCTGATGATCACGAATTGTGCACCGATGTTT
ACATTAACAACGATAAATGTAAATTGAAAAATTTCCAAAAAAAAATTTATTTAATTTAAT
TTTAACAAATAAAGACTACATCAGAGGTATTGAATACGAATAAGGTTACTTCCCTGAAGG
CAAGCCCTACTGA