Identifiers and Description

Gene Model Identifier

TTHERM_00088060

Standard Name

PCS1 (PhytoChelatin Synthase )

Aliases

PreTt16456 | 6.m00530 | 3836.m02122

Description

Phytochelatin synthase; gamma-glutamylcysteine dipeptidyl-transpeptidase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05023 ) Phytochelatin synthase
  • ( PF09328 ) Domain of unknown function (DUF1984)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.3%

TetraMine Data

TTHERM_00088060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02494.19.997093137033517e-262phytochelatin synthase (449 aa
)
DictyBaseDDB_G02911876.001055639413166e-58DDB_G0291187 on chromosome: 5
position 5037394 to 5039386
WormBaseWBGene000039602.000364041471746e-45locus:pcs-1 status:Confirmed
UniProt:A5JYS1 protein_id
:CAN86619.1
OxytrichaContig12274.0.g331.0004783691736523e-35Phytochelatin synthase
Stentor CoeruleusSteCoe_98902.6786369618080778e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00088060(coding)
ATGTCTCGTTCACTATTCAAGAAAATGTTCTATTAATTTTCAGCAGTAGAACAATAAGTT
TAAACAGTTTATAAGCGTCCTCTACCAAAAATATTGATTAATTTTTCGAGTGAATAAGGT
AAAAAACTATTTAAAGAAGCACTTGAAGAGGGTAATATGGAATGTTATTTTCCTTTAAGT
GAATAATTTATGACTTAGCTTGAACCTTCAACATGTGGTTCTACTACATTAGCGATGGTA
CTTAATACGTTAAATTTAGACCCAAAAAAGCGCTGGAAAGGAATATGGAGATGGTATAGC
GAAGAAACTTTAGAGGGGATGAAACCAGAATATATTAAATAGGGAATTGATTTAGAAAAT
TTTTCTCACATAACAAAGCATAATAACGCATCTATTTAAACATTTTATTATCCACATGAA
CATTAAAGTTAATCTTCAAAATATGACTGTGAATATCACTGCTCTAAAGATAAAATAAAA
TCAGCTTCTTATTCAACTTTTGTTATTTGCCTCACTGCTTGTTGTCGTCGCACTGGACTA
TATATGGTCTTAAACTAATCAAGAAAAGCTCTTAGTTAAACAGGAGAGGGACATTTTTAG
CCTGTCGGTGGATTAAATATGGCTCATTAAAAAGCTTTGATGTTTGATGTAGCAAGATTT
AAATATCCTCCTTATTGGTGCAACTTAGATCTTTTATATGAGTCACTTAAAAGTTTAGAC
AATGTAACTAAAAGACCTAGAGGATTTGCTTTAATATCAAGGGATTTAGAAAATTTTAGC
AAGATTTGCAGCATTAGTCCTGACTAAGTGTCTAAAAAGAAACTTTAAATAAAGCTGCAA
AGTGAGAATTTTATGAGTAATTACAAAGATATAGATTATAAATATGATTTAATAGATTTC
TACTAAAGTTTTTTAAAAGAGATGGGATTTGATTTTTCTGTTTTATTGGTTTATAATATG
TATGAAGTTATGAATTACTTTGAAAAGTAAGGAGAATAAGCAGATTATTTGTTTTAGGCT
TTTTCTAAAAATTAAATTTACAAAATTAGTGAAAAAATAATTTGCAAGTTATTAGAGGAA
AAGAGTGAAGTAGGAATTTTGATAACAGAATTTTGTGGAAATTATGCTCCATTGATCGCT
AGTTTAGTTCTTTTATCGATTCCTGAAAGTTAATATATGAAAATTAATAAAAATTTATAC
AAAAACGATATCAAAAAATTAATTGATGAATATAAAGATTTAGACCATAAAGAAAATTTA
GACAACGAATTAGAAATTGAAATTAGGAAATATATGAAATAAATTGTTGTGTCCTTTAAA
AATAATCTTTTTTAAAGTTGA


>TTHERM_00088060(protein)
MSRSLFKKMFYQFSAVEQQVQTVYKRPLPKILINFSSEQGKKLFKEALEEGNMECYFPLS
EQFMTQLEPSTCGSTTLAMVLNTLNLDPKKRWKGIWRWYSEETLEGMKPEYIKQGIDLEN
FSHITKHNNASIQTFYYPHEHQSQSSKYDCEYHCSKDKIKSASYSTFVICLTACCRRTGL
YMVLNQSRKALSQTGEGHFQPVGGLNMAHQKALMFDVARFKYPPYWCNLDLLYESLKSLD
NVTKRPRGFALISRDLENFSKICSISPDQVSKKKLQIKLQSENFMSNYKDIDYKYDLIDF
YQSFLKEMGFDFSVLLVYNMYEVMNYFEKQGEQADYLFQAFSKNQIYKISEKIICKLLEE
KSEVGILITEFCGNYAPLIASLVLLSIPESQYMKINKNLYKNDIKKLIDEYKDLDHKENL
DNELEIEIRKYMKQIVVSFKNNLFQS


>TTHERM_00088060(gene)
ATGTCTCGTTCACTATTCAAGAAAATGTTCTATTAATTTTCAGCAGTAGAACAATAAGTT
TAAACAGTTTATAAGCGTCCTCTACCAAAAATATTGATTAATTTTTCGAGTGAATAAGGT
AATATATGGAAACATGTTTTACAATTTTAATATATTAAGCAATAAATATGATGATTAAAA
AAGAATATAAAATATGGGCGATGCTATTTAATTTACAAAAAGAAAATATTTATTTTATAA
ATATAAGGTAAAAAACTATTTAAAGAAGCACTTGAAGAGGGTAATATGGAATGTTATTTT
CCTTTAAGTGAATAATTTATGACTTAGCTTGAACCTTCAACATGTGGTTCTACTACATTA
GCGATGGTACTTAATACGTTAAATTTAGACCCAAAAAAGCGCTGGAAAGGGTAAAAAATT
AAATAATAATTAATGTTATTTCTAAGTTTAAGTTTTTTATAATAAAATAACTTTCTTTAT
ATAAAATAGAATATGGAGATGGTATAGCGAAGAAACTTTAGAGGGGATGAAACCAGAATA
TATTAAATAGGGAATTGATTTAGAAAATTTTTCTCACATAACAAAGCATAATAACGCATC
TATTTAAACATTTTATTATCCACATGAACATTAAAGTTAATCTTCAAAATATGACTGTGA
ATATCACTGCTCTAAAGATAAAATAAAATCAGCTTCTTATTCAACTTTTGTTATTTGCCT
CACTGCTTGTTGTCGTCGCACTGGACTATATATGGTCTTAAACTAATCAAGAAAAGCTCT
TAGTAAAAATTTATTTTGTTTATTTATTTAAGCATTACAAAAATATAATGATTATGCTAT
GTACCTCTTTATTTCATAGTTAAATAATAGCTTTAGTATTTTTAGGTAGTACAATGCATA
TCAGATATTTCCATATTAGATATTAATTAGATGATAGAATACTTTAAATGCGTTAATATA
TCTTTTCTGGAATAATCCTAACAACTATTTATTCAAACATAACAAATATTTGAATTTATA
TTTAACAAAATAAATTAAAAATCAATTATCAGAAAACATTTTTAATTAACAATAGCATTT
AAATGTTAAAATTAAAGTTTGATAAATTGAAATATTAATTTAACAAAATTAGAATATCAA
ATATTAAGAGAAAATTAACACAATTTTGTTTAAGGAAATAAAAATAAACGATTATAAAAT
AAGAAATTAATTTTTTTAATCCAGCCAGAAAATTATCATAAAAAGTTAATGCATTTAAAA
ATATTTTTTTAAATTTCTTCAAAATTGACAAACTAATAATAAAATTTTATTTAAAAATAA
AACACAATGATTAATTTTATTCAACATAATTTTAAATAAGAGAATAAAAATAAATCATAA
AAAATAAGATATTCATCATTCTTTTTTTAATTAAATAAATAAACTTAATAGATTTTTTAA
TATTTAAGCAATATATAAGAAAAGGAAGTTATGTTTTCAAATAAAATTTAAAAATAAAAC
TCTATACCTTATGTGAAGTCTAGGATAGAATTATTTAATTAAATAAATAAATAGAAATAT
TTGATAAAAATAATAATGAAATGAATAGTTATCGAAAAAATAGAAAGAAATTAAAGTAAT
TTGGAAATGACCATAATGAAAAAAAAAAATTTTAAATGACTCAATAAAATAAAATAGATT
TGTAAAGCCTTCTTTTAAAATATTTTATTTTAAGGAATAAATTAATAGAAATGAATACTT
TTAAAGCTAAAAAATATATGAAAAATACTTTTTAAAAATGAAACTCTAGTTTATTTTTTA
ATATTGTTTCATATAAAACTAATAAATTTATTTATCATTTTAATAAAAAAGGTTAAACAG
GAGAGGGACATTTTTAGCCTGTCGGTGGATTAAATATGGCTCATTAAAAAGCTTTGATGT
TTGATGTAGCAAGATTTAAATATCCTCCTTATTGGTGCAACTTAGATCTTTTATATGAGT
CACTTAAAAGTTTAGACAATGTAACTAAAAGACCTAGAGGATTTGCTTTAATATCAAGGG
ATTTAGAAAATTTTAGCAAGATTTGCAGCATTAGTCCTGACTAAGTGTCTAAAAAGAAAC
TTTAAATAAAGCTGCAAAGTGAGAATTTTATGAGTAATTACAAAGATATAGATTATAAAT
ATGATTTAATAGATTTCTACTAAAGTTTTTTAAAAGAGATGGGATTTGATTTTTCTGTTT
TATTGGTTTATAATATGTATGAAGTTATGAATTACTTTGAAAAGTAAGGAGAATAAGCAG
ATTATTTGTTTTAGGCTTTTTCTAAAAATTAAATTTACAAAATTAGTGAAAAAATAATTT
GCAAGTTATTAGAGGAAAAGAGTGAAGTAGGAATTTTGATAACAGAATTTTGTGGAAATT
ATGCTCCATTGATCGCTAGTTTAGTTCTTTTATCGATTCCTGAAAGTTAATATATGAAAA
TTAATAAAAATTTATACAAAAACGATATCAAAAAATTAATTGATGAATATAAAGATTTAG
ACCATAAAGAAAATTTAGACAACGAATTAGAAATTGAAATTAGGAAATATATGAAATAAA
TTGTTGTGTCCTTTAAAAATAATCTTTTTTAAAGTTGA