Identifiers and Description

Gene Model Identifier

TTHERM_01087780

Standard Name

PCP2 (PARP Correlated Protein 2)

Aliases

PreTt05179 | 227.m00035

Description

Poly polymerase and DNA-Ligase Zn-finger region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02037 ) SAP domain
  • ( PF08063 ) PADR1 (NUC008) domain
  • ( PF00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01087780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20055.12.0008734984431652e-95poly polymerase and DNA-Ligase
Zn-finger region family prote
in (255 aa)
WormBaseWBGene000040490.0000007001298633766835locus:pme-1 Poly(ADP-ribose)
polymerase pme-1 status:Con
firmed UniProt:Q9N4H4 prot
ein_id:CCD73512.1
DictyBaseDDB_G02918720.0000029996948234116693DDB_G0291872 on chromosome: 6
position 855161 to 857960

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01087780(coding)
ATGGTCCAATTATCAATAGAAAAAGCCAAATCAGCAAGATCTTCTTGCAAATAATGCAAA
TAGAAGATCGCAAAAGATGAAGTGCGTGTAGGAATAAGTATTTCTAAAGGAGACTATGAT
GAAACTTCTTGGTATCATGTTTCATGCTTTTCTAAGACTAAATTTGCAGGATCTAAAGAC
ATCGAAGATTTAGATGGCTACAGTGCCTTATCAGGAACAGAACAAGCAGAAGCCAAAAAG
AATTTTGATAAGGGAGCCAAAGCTGCTAAAGGTAAAGCAAAGGGTAAAAAAGGATCAAAA
AGTGAATCAGATGAGCCTGAAAGCGGAGACGAAAGTGATGAAGACTCTGGAAAAGGTAAA
AATGGTGCAAAAAAAGGAGCTGCCAAAAAGGGAAGCTCTGGAGGTGCCTTAGCAGGCTAT
ACAGCAGCTGAAAAAGCAAAATATGAAAAGTATTATGAAGAAGCTTTAAAATTATCTGTT
GCTGCTATCAAATAAGCTCTCAAAAAGAATGGTATGACTCAAAATGGAAATAAACAAGAA
ATCGCTTCAAGAATGGCTGATTGCTAAACTATGGGAACTCTCCCAAATTGCTCAAAATGT
GGAGGAGGTAGACTTAGATTTAACTAACAGGATGGTACTTACTTCTGCAAGGGCTACATG
GATGATGCAGATTTTGTCAACTGCTCAGCAAAATATCCCAAAAGTGAAATCACTCGTGGC
ACTTGGACTGATTGA


>TTHERM_01087780(protein)
MVQLSIEKAKSARSSCKQCKQKIAKDEVRVGISISKGDYDETSWYHVSCFSKTKFAGSKD
IEDLDGYSALSGTEQAEAKKNFDKGAKAAKGKAKGKKGSKSESDEPESGDESDEDSGKGK
NGAKKGAAKKGSSGGALAGYTAAEKAKYEKYYEEALKLSVAAIKQALKKNGMTQNGNKQE
IASRMADCQTMGTLPNCSKCGGGRLRFNQQDGTYFCKGYMDDADFVNCSAKYPKSEITRG
TWTD


>TTHERM_01087780(gene)
ATGGTCCAATTATCAATAGAAAAAGCCAAATCAGCAAGATCTTCTTGCAAATAATGCAAA
TAGAAGATCGCAAAAGATGAAGTGCGTGTAGGAATAAGTATTTCTAAAGGAGACTATGAT
GAAACTTCTTGGTATCATGTTTCATGCTTTTCTAAGACTAAATTTGCAGGATCTAAAGAC
ATCGAAGATTTAGATGGCTACAGTGCCTTATCAGGAACAGAACAAGCAGAAGCCAAAAAG
AATTTTGATAAGGGAGCCAAAGCTGCTAAAGGTAAAGCAAAGGGTAAAAAAGGATCAAAA
AGTGAATCAGATGAGCCTGAAAGCGGAGACGAAAGTGATGAAGACTCTGGAAAAGGTAAA
AATGGTGCAAAAAAAGGAGCTGCCAAAAAGGGAAGCTCTGGAGGTGCCTTAGCAGGCTAT
ACAGCAGCTGAAAAAGCAAAATATGAAAAGTATTATGAAGAAGCTTTAAAATTATCTGTT
GCTGCTATCAAATAAGCTCTCAAAAAGAATGGTATGACTCAAAATGGAAATAAACAAGAA
ATCGCTTCAAGAATGGCTGATTGCTAAACTATGGGAACTCTCCCAAATTGCTCAAAATGT
GGAGGAGGTAGACTTAGATTTAACTAACAGGATGGTACTTACTTCTGCAAGGGCTACATG
GATGATGCAGATTTTGTCAACTGCTCAGCAAAATATCCCAAAAGTGAAATCACTCGTGGC
ACTTGGACTGATTGA