Identifiers and Description

Gene Model Identifier

TTHERM_00681750

Standard Name

PCP1 (PARP Correlated Protein 1)

Aliases

PreTt16112 | 103.m00103 | 3734.m00016

Description

Poly polymerase and DNA-Ligase Zn-finger region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF08063 ) PADR1 (NUC008) domain
  • ( PF00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00681750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14722.16.0023901016598e-137poly polymerase and DNA-Ligase
Zn-finger region family prote
in (324 aa)
Stentor CoeruleusSteCoe_105420.0000000000006914400106940203
DictyBaseDDB_G02918720.00006000996057121373DDB_G0291872 on chromosome: 6
position 855161 to 857960

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00681750(coding)
ATGAGCGCGAAAGAATTAAAGTTTGATTATGCAAGCTCAAGTAGAGCTGGATGCAAAGGA
TGTAAAATGAAAATTTAAAAAAATGAGCTTAGAATAGGATTAGAAACTCTCTTTTAAGGT
GAGCATACAACGACTTCATGGAGACATTTAGAATGCTTTAGTCTTGGTAGAAAATATAAA
GATATTGATCCTAAAGAAATTGAAGGTTATTATGATTTAAAAAAGGAAGATAAAGCTAGG
GTAATAGATTACTTTGAAGGAGGTGGTCAAAAAAAATCTGTAGTTGATAAACTGATATCT
ACAATAACAGATTCAGAAAAGAAAAAAAAATAAGACGATGATGGTGATGACAATCAAGTT
TATGATTACGATGCTGAATAATAGAAGAAGAAAAATTAATAGTAAAAAGAAAAGAAAAAA
ATTACTAAACCTAAATTAAAAAGAAAGCTATCAAGTTCTTCAGAAGAGGAAGATGATTCG
TCTGATTCAGAAGATGATTTTGATGACTCAGAGACTGATAACTCAGGTAGTGATAGTGAT
TATGAAAAAGAAAAAGCTATCTAAAGAAAAAATCAACATAAAAAATTAGCAAGAAAAAAA
AAATCAAAAGGAAAAAGTAAAAGCAGCACTGAAATAAATATTGGTTACACTCCTGAATAG
TTACTTAAATTCAAAGAAAATTTAAAATTATATGAAAAAAAAACTGCAGAATACTTAAAG
GCTTTATTAGGAATTAACAATTAGCCTAAAACTGGTACAAAGGATGAATTAGTTTTGAAA
TGCGCAGATGGTAAAACACTTGGACAAATTCCAATATGTTCTGAGTGTGGTGGAGGGAAA
TTAAGGTATGATATATAAACTGGTATTTACAAATGTCCTGGATATATGGATGATGATGTT
TTTTAGCATTGTGGTAAAAAATTTACAAATGAATAAATTGTCAGATTACCTTGGATTGAT
GATATTATTTGA


>TTHERM_00681750(protein)
MSAKELKFDYASSSRAGCKGCKMKIQKNELRIGLETLFQGEHTTTSWRHLECFSLGRKYK
DIDPKEIEGYYDLKKEDKARVIDYFEGGGQKKSVVDKLISTITDSEKKKKQDDDGDDNQV
YDYDAEQQKKKNQQQKEKKKITKPKLKRKLSSSSEEEDDSSDSEDDFDDSETDNSGSDSD
YEKEKAIQRKNQHKKLARKKKSKGKSKSSTEINIGYTPEQLLKFKENLKLYEKKTAEYLK
ALLGINNQPKTGTKDELVLKCADGKTLGQIPICSECGGGKLRYDIQTGIYKCPGYMDDDV
FQHCGKKFTNEQIVRLPWIDDII


>TTHERM_00681750(gene)
ATGAGCGCGAAAGAATTAAAGTTTGATTATGCAAGCTCAAGTAGAGCTGGATGCAAAGGA
TGTAAAATGAAAATTTAAAAAAATGAGCTTAGAATAGGATTAGAAACTCTCTTTTAAGGT
GAGCATACAACGACTTCATGGAGACATTTAGAATGCTTTAGTCTTGGTAGAAAATATAAA
GATATTGATCCTAAAGAAATTGAAGGTTATTATGATTTAAAAAAGGAAGATAAAGCTAGG
GTAATAGATTACTTTGAAGGAGGTGGTCAAAAAAAATCTGTAGTTGATAAACTGATATCT
ACAATAACAGATTCAGAAAAGAAAAAAAAATAAGACGATGATGGTGATGACAATCAAGTT
TATGATTACGATGCTGAATAATAGAAGAAGAAAAATTAATAGTAAAAAGAAAAGAAAAAA
ATTACTAAACCTAAATTAAAAAGAAAGCTATCAAGTTCTTCAGAAGAGGAAGATGATTCG
TCTGATTCAGAAGATGATTTTGATGACTCAGAGACTGATAACTCAGGTAGTGATAGTGAT
TATGAAAAAGAAAAAGCTATCTAAAGAAAAAATCAACATAAAAAATTAGCAAGAAAAAAA
AAATCAAAAGGAAAAAGTAAAAGCAGCACTGAAATAAATATTGGTTACACTCCTGAATAG
TTACTTAAATTCAAAGAAAATTTAAAATTATATGAAAAAAAAACTGCAGAATACTTAAAG
GCTTTATTAGGAATTAACAATTAGCCTAAAACTGGTACAAAGGATGAATTAGTTTTGAAA
TGCGCAGATGGTAAAACACTTGGACAAATTCCAATATGTTCTGAGTGTGGTGGAGGGAAA
TTAAGGTATGATATATAAACTGGTATTTACAAATGTCCTGGATATATGGATGATGATGTT
TTTTAGCATTGTGGTAAAAAATTTACAAATGAATAAATTGTCAGATTACCTTGGATTGAT
GATATTATTTGA