Identifiers and Description

Gene Model Identifier

TTHERM_01107420

Standard Name

PCNA1 (proliferating cell nuclear antigen 1)

Aliases

PreTt28091 | 237.m00048 | 3794.m00183

Description

proliferating cell nuclear antigen (pcna)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01107420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20275.13.9987282255476324e-176proliferating cell nuclear ant
igen (pcna) (262 aa)
OxytrichaContig12091.0.g38.003265703977305e-104Proliferating cell nuclear ant
igen, N-terminal domain
WormBaseWBGene000039552.9993408039826107e-81locus:pcn-1 Proliferating ce
ll nuclear antigen status:Co
nfirmed UniProt:O02115 pro
tein_id:CCD66765.1
DictyBaseDDB_G02876072.0001503375893664e-79pcna on chromosome: 5 position
463300 to 464157
SGDYBR088C3.0000115468388957e-66POL30 Proliferating cell nucle
ar antigen (PCNA), functions a
s the sliding clamp for DNA po
lymerase delta; may function a
s a docking site for other pro
teins required for mitotic and
meiotic chromosomal DNA repli
cation and for DNA repair
Stentor CoeruleusSteCoe_318164.0795586671775603e-41

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_01107420(coding)
ATGTTTGAAGCTAAATTACAATAAGGTGTTATTTTCAAAAAAATCGTCGATGCTATCAAG
GATTTAGTTAAATCAGTTAATATCGATGCTAGCACTAGTGGTCTTTCCATGCAAGCTATG
GATTCAGCTCACGTTGCTTTGGTTTCCCTCAAGTTAAATGAAAATGGTTTCAAGGATTAT
AGATGTGACAGACCAATCACTCTTGGTCTTTCTATTGAAAACCTTTCCAAGATCCTCAAG
TGTGCTGGAAATGATGACACTATTACCTTATAAACTGATGAAGAAGAACCTTCTTCCCTT
AAATTCTTCTTTGAAAATTAATAGGCCTCTAAGATCTCCGAATTTAGTTTGAACTTAATG
TCATTAGATAGTGAATCTTTGGGTATCCCCGACACCGATTATTCTTCTGTTATTCAAATG
TCCTCAGCTGAATTCTCTAGAATCTGCAAGGAACTTAGTTCTATTTCTGAAACAGTTGAA
ATTGAAACTAGCAAAGAATCTGTTAAGTTTAGCGTTTAAGGAGATATTGGTGCTGGTTCA
ATCACTGTCAAGAATAACTAAAGTGATAAAGATGTTGACCGTGTTGATTTACAAATTGAT
TAACCCGTTAAGTTAACCTTCGCTCTTAGATATTTGAATATGTTCAATAAGGCTGTCTCT
CTTAGCAGTACTGTTAGTTTAAATATGTCTGAAGAAAATCCTCTTATGGTTGAATATAAA
ATCGATGATCTTGGTTCTCTTAGATTCTATCTTGCTCCTAAGATTTCTGATGAAGAAAGT
AGTTGA


>TTHERM_01107420(protein)
MFEAKLQQGVIFKKIVDAIKDLVKSVNIDASTSGLSMQAMDSAHVALVSLKLNENGFKDY
RCDRPITLGLSIENLSKILKCAGNDDTITLQTDEEEPSSLKFFFENQQASKISEFSLNLM
SLDSESLGIPDTDYSSVIQMSSAEFSRICKELSSISETVEIETSKESVKFSVQGDIGAGS
ITVKNNQSDKDVDRVDLQIDQPVKLTFALRYLNMFNKAVSLSSTVSLNMSEENPLMVEYK
IDDLGSLRFYLAPKISDEESS


>TTHERM_01107420(gene)
ATGTTTGAAGCTAAATTACAATAAGGTGTTATTTTCAAAAAAATCGTCGATGCTATCAAG
GATTTAGTTAAATCAGTTAATATCGATGCTAGCACTAGTGGTCTTTCCATGCAAGCTATG
GATTCAGCTCACGTTGCTTTGGTTTCCCTCAAGTTAAATGAAAATGGTTTCAAGGATTAT
AGATGTGACAGACCAATCACTCTTGGTCTTTCTATTGAAAACCTTTCCAAGATCCTCAAG
TGTGCTGGAAATGATGACACTATTACCTTATAAACTGATGAAGAAGAACCTTCTTCCCTT
AAATTCTTCTTTGAAAATTAATGTAATTTATTAGGACAAAAATAATTATTTTATTCTAAA
CTTTGTACATGTTTTCTTTTGGAATAAATTAAACTGAACATATTTAGAATACTCTACTTT
TACAATACTCTACTTTTATAATATTATATAATATATCCTTATTCATTCTATTAATCATTT
GATACAATTTTTTCAATGCTAATCAAAATTAAAATTATTTTTTTTATTATTTTGTAGAGG
CCTCTAAGATCTCCGAATTTAGTTTGAACTTAATGTCATTAGATAGTGAATCTTTGGGTA
TCCCCGACACCGATTATTCTTCTGTTATTCAAATGTCCTCAGCTGAATTCTCTAGAATCT
GCAAGGAACTTAGTTCTATTTCTGAAACAGGTAAACAATAATAGATGTTAAATTCAAAGA
AGTAGATCATACTTAATCTAGATAATAATGTTTAAACTTAAAAATTAAGAAGTAGCTCTT
AAAAATTTTGAAAATTAGTTAAGTTAAGTATGGTTGACCTTCACTAAATGCATTAGATTA
TTATTAGATATATAAATTAATATTGTTTTTAAAAAATAAAATAGTTGAAATTGAAACTAG
CAAAGAATCTGTTAAGTTTAGCGTTTAAGGAGATATTGGTGCTGGTTCAATCACTGTCAA
GAATAACTAAAGTGATAAAGATGTTGACCGTGTTGATTTACAAATTGATTAACCCGTTAA
GTTAACCTTCGCTCTTAGATATTTGAATATGTTCAATAAGGCTGTCTCTCTTAGCAGTAC
TGTTAGTTTAAATATGTCTGAAGAAAATCCTCTTATGGTTGAATATAAAATCGATGATCT
TGGTTCTCTTAGATTCTATCTTGCTCCTAAGATTTCTGATGAAGAAAGTAGTTGA