Identifiers and Description

Gene Model Identifier

TTHERM_00013120

Standard Name

PAT1 (Pot1 associated in Tetrahymena 1)

Aliases

PreTt11818 | 1.m00866

Description

Pot1a-associated telomere protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08561 ) Mitochondrial ribosomal protein L37

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00013120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02737.12.000319284850678e-127hypothetical protein (371 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24297442: Premkumar VL, Cranert S, Linger BR, Morin GB, Minium S, Price C (2014) The 3' overhangs at Tetrahymena thermophila telomeres are packaged by four proteins, Pot1a, Tpt1, Pat1, and Pat2. Eukaryotic cell 13(2):240-5
  2. Ref:25303953: Cranert S, Heyse S, Linger BR, Lescasse R, Price C (2014) Tetrahymena Pot2 is a developmentally regulated paralog of Pot1 that localizes to chromosome breakage sites but not to telomeres. Eukaryotic cell 13(12):1519-29
  3. Ref:21900503: Linger BR, Morin GB, Price CM (2011) The Pot1a-associated proteins Tpt1 and Pat1 coordinate telomere protection and length regulation in Tetrahymena. Molecular biology of the cell 22(21):4161-70

Sequences

>TTHERM_00013120(coding)
ATGAATTAGAAAAAACAAAAAGAAACAGAAAGCAATATTGATATTTTTAGATTGCTTTCA
GATGGAATAAAGAGTTATGAGCAAAAAGGTTTGAATCTTAAATTAAAAGAAAAATCATCT
AATACTAAACTGCCATATTGCTTATACGAAGATTTAAAGATTATATTTGAGTTTAGTTAA
AATTCGGAATCGAAATTAACTGTCTTTAAGTAGCTTGCAAGTAATTAGTTATCTCATAGA
TCAGAAGATTCAATAAGGAGTCGTTATAGAGATTTCATTTAAGAATTAAATCCTTCTGAT
TTTTAAAATATTTCAAAATATGTTATTGAGAAAAGATCCATTGAAGGATATCTTGTAAAA
GAGAGAGATGAGCATGGAAACAAAACATATGTTGTAAAGGATCAGTTAAAAACAACAAGT
AGCGAAAGTAAATCTTAAAAGAATCCTTCAAAAAAGACTGTTGAACAATAATAAAGTAAA
AGTAAAGAAGAAATAAAATTGCCTTTGAAGAGAAAGCCTGAAAACGTACCTGAAATTCTT
ATAAATGGAAAAAAATAACTCAAATCTACCAAACCAGATAATCATTAAAAGGAGCCTGCA
CAAAAGATTAAACAATAAGATCAAAATAACTTAGAAGAGGAAGAAGAAAAAGAGTTTCAA
TACAAAAAGACTTAAAAAAATAAAAGCTAGATAAATTAAGTAAATGAAGTTGATTCAAGA
AATAAAAAGAATTAAAATAACTAAATGGAAGTTCAATAACCATAGCCCAAGTAAAATCAA
TAGCAATAACAACAAGCTTAAGCTCATAAAATATCTAATTAACTGAGTGAGTAGGAATAT
AAAGATGCAAGGGAGTTAGATGTCTATATTCACTTCCTAGCTAATTATGAAAATGTACAA
AAAAAGAGTTTGATCCACACTCTAGACAAGCTATCTGGAGATTTCAATTAACTTGTTGAC
TATTTATAAACTCAAAACCATAATTTACTCTGGAAAGAAGACGAAGACGAAGTCTTACGC
AATTTTAGTGAGCAATCATCTCAAACTATCTACCTACTTAAAACCTTAAAAAAAGGAAAA
GAAAATATCTTAAGAAGAGCTACTTATCTAGGCATAGAACTCCCAGATTTTGAATGA


>TTHERM_00013120(protein)
MNQKKQKETESNIDIFRLLSDGIKSYEQKGLNLKLKEKSSNTKLPYCLYEDLKIIFEFSQ
NSESKLTVFKQLASNQLSHRSEDSIRSRYRDFIQELNPSDFQNISKYVIEKRSIEGYLVK
ERDEHGNKTYVVKDQLKTTSSESKSQKNPSKKTVEQQQSKSKEEIKLPLKRKPENVPEIL
INGKKQLKSTKPDNHQKEPAQKIKQQDQNNLEEEEEKEFQYKKTQKNKSQINQVNEVDSR
NKKNQNNQMEVQQPQPKQNQQQQQQAQAHKISNQLSEQEYKDARELDVYIHFLANYENVQ
KKSLIHTLDKLSGDFNQLVDYLQTQNHNLLWKEDEDEVLRNFSEQSSQTIYLLKTLKKGK
ENILRRATYLGIELPDFE


>TTHERM_00013120(gene)
AAATCAACCAATTTATCACTTTAAGAAGTAAGATTAATGAATTAGAAAAAACAAAAAGAA
ACAGAAAGCAATATTGATATTTTTAGATTGCTTTCAGATGGAATAAAGAGTTATGAGCAA
AAAGGTTTGAATCTTAAATTAAAAGAAAAATCATCTAATACTAAACTGCCATATTGCTTA
TACGAAGATTTAAAGATTATATTTGAGTTTAGTTAAAATTCGGAATCGAAATTAACTGTC
TTTAAGTAGCTTGCAAGTAATTAGTTATCTCATAGATCAGAAGATTCAATAAGGAGTCGT
TATAGAGATTTCATTTAAGAATTAAATCCTTCTGATTTTTAAAATATTTCAAAATATGTT
ATTGAGAAAAGATCCATTGAAGGATATCTTGTAAAAGAGAGAGATGAGCATGGAAACAAA
ACATATGTTGTAAAGGATCAGTTAAAAACAACAAGTAGCGAAAGTAAATCTTAAAAGAAT
CCTTCAAAAAAGACTGTTGAACAATAATAAAGTAAAAGTAAAGAAGAAATAAAATTGCCT
TTGAAGAGAAAGCCTGAAAACGTACCTGAAATTCTTATAAATGGAAAAAAATAACTCAAA
TCTACCAAACCAGATAATCATTAAAAGGAGCCTGCACAAAAGATTAAACAATAAGATCAA
AATAACTTAGAAGAGGAAGAAGAAAAAGAGTTTCAATACAAAAAGACTTAAAAAAATAAA
AGCTAGATAAATTAAGTAAATGAAGTTGATTCAAGAAATAAAAAGAATTAAAATAACTAA
ATGGAAGTTCAATAACCATAGCCCAAGTAAAATCAATAGCAATAACAACAAGCTTAAGCT
CATAAAATATCTAATTAACTGAGTGAGTAGGAATATAAAGATGCAAGGGAGTTAGATGTC
TATATTCACTTCCTAGCTAATTATGAAAATGTACAAAAAAAGAGTTTGATCCACACTCTA
GACAAGCTATCTGGAGATTTCAATTAACTTGTTGACTATTTATAAACTCAAAACCATAAT
TTACTCTGGAAAGAAGACGAAGACGAAGTCTTACGCAATTTTAGTGAGCAATCATCTCAA
ACTATCTACCTACTTAAAACCTTAAAAAAAGGAAAAGAAAATATCTTAAGAAGAGCTACT
TATCTAGGCATAGAACTCCCAGATTTTGAATGA