Identifiers and Description

Gene Model Identifier

TTHERM_00133730

Standard Name

PARS11 (PARtner of Spo11)

Aliases

PreTt24296 | 10.m00345 | 3698.m00067

Description

Protein required for the formation and control of meiotic DNA double-strand breaks. Functionally similar to budding yeast Rec114.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00133730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05736.13.999543040313994e-55hypothetical protein (181 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30357385: Tian M, Loidl J (2018) A chromatin-associated protein required for inducing and limiting meiotic DNA double-strand break formation. Nucleic acids research ( ):
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00133730(coding)
ATGAGTCTGAAAACATATATCAATAAGAAGAAAAGCTAAAACTTAGGTTCTTCATAGTCA
TCGGCTGCAGCTCTCACATCACTTTAGTCAAATTGCTTTACAGCAAAGGGATAAATGGTT
TCTTAAAATAGCTAGAACTCACAGAATACCATTCAAATGCAGTGCAATACACAAACTCAG
TAGATACTCTCACAAGCTTCATAATTTCCTGTGCCTAAAAACTCTAGCCTTATGATTGAA
GAACCAAATATCTTTGGATAAACTGGATACAGCTCATTCAAAAATAAGAACCTAAATTCT
ACTTAGAATACATCCTTTTTAAATTAGTTATCCTAAGACGAAGCTAATGATTCTTACAAT
TAAATTCTACATGAGAATAATTTTATTTAAAATCCTAATCTGAACTAAAGCTTTCTAAAT
TAAAGCTATCAACTTCTTTCATAGCATAACCTAAAGTAATCACAATTGTTTCTTCCAGCG
ATCCAAGAAAGTAAGGTCTCTTAATTTGATGGTAAGTCTAGCTAGATATTTAATCCTTCT
GAATCAAGGCTAAATCATCCTAATCTGATATAAAGTAGCTTGATGGTTGGACAAATTTCT
TAGTAATAATAACTTGCAAATATTTCGCTGCAGCTCTTATAAGATGAAATATTGAAATAA
AAGATTGAATAAAGAGAAAGAGAATTAATCCTAAAGCAAGAATTGCTATAAGAAATGAGA
GATTTAAAACACTTTTTCTAGAGCAATGTAATTAAATAAATAGAAGATAAAAATGAATAA
ATGCAGGGTGAGTGTTAGAAGAGCATTGAAGAAGTTTAAAAAAAGGTGGAAAATGTTGTT
AAAACTATTTTTGATTACATCAAAGATGAAAAGCAAGAGGAAAAAAAGAAAAACTCTGTA
GCATAATCAGACTATGCATAGGATATTTCAGATTTATATAATACTGTTAATTCCATTAAA
GGAAAATTAGATAAAGAAGGTTTAAATCAATAATTTTAACAAGATTTGAATAAAGCTATA
AAGATCATATTTAGTAAAATCAACTCTGCAAAAAGATCTGTAAAAAAACAGATTGTTCAA
ACAAACATGAGTCTAAGGAATAAAAGGAAAAAGGCAACCTAAACTTAAAATAATTGA


>TTHERM_00133730(protein)
MSLKTYINKKKSQNLGSSQSSAAALTSLQSNCFTAKGQMVSQNSQNSQNTIQMQCNTQTQ
QILSQASQFPVPKNSSLMIEEPNIFGQTGYSSFKNKNLNSTQNTSFLNQLSQDEANDSYN
QILHENNFIQNPNLNQSFLNQSYQLLSQHNLKQSQLFLPAIQESKVSQFDGKSSQIFNPS
ESRLNHPNLIQSSLMVGQISQQQQLANISLQLLQDEILKQKIEQRERELILKQELLQEMR
DLKHFFQSNVIKQIEDKNEQMQGECQKSIEEVQKKVENVVKTIFDYIKDEKQEEKKKNSV
AQSDYAQDISDLYNTVNSIKGKLDKEGLNQQFQQDLNKAIKIIFSKINSAKRSVKKQIVQ
TNMSLRNKRKKATQTQNN


>TTHERM_00133730(gene)
CAAATTAAAATTATTAAATTATCAAAATAAAAAACACCAAAAAGATTAAAAAAATCAGAA
GTAAGAAAAAATACAAATATGAGTCTGAAAACATATATCAATAAGAAGAAAAGCTAAAAC
TTAGGTTCTTCATAGTCATCGGCTGCAGCTCTCACATCACTTTAGTCAAATTGCTTTACA
GCAAAGGGATAAATGGTTTCTTAAAATAGCTAGAACTCACAGAATACCATTCAAATGCAG
TGCAATACACAAACTCAGTAGATACTCTCACAAGGTATTTATTTTAATAGTTCAATTTGT
AATTAATTTAAATATTTAATCTCTCAGCTTCATAATTTCCTGTGCCTAAAAACTCTAGCC
TTATGATTGAAGAACCAAATATCTTTGGATAAACTGGATACAGCTCATTCAAAAATAAGA
ACCTAAATTCTACTTAGAATACATCCTTTTTAAATTAGTTATCCTAAGACGAAGCTAATG
ATTCTTACAATTAAATTCTACATGAGAATAATTTTATTTAAAATCCTAATCTGAACTAAA
GCTTTCTAAATTAAAGCTATCAACTTCTTTCATAGCATAACCTAAAGTAATCACAATTGT
TTCTTCCAGCGATCCAAGAAAGTAAGGTCTCTTAATTTGATGGTAAGTCTAGCTAGATAT
TTAATCCTTCTGAATCAAGGCTAAATCATCCTAATCTGATATAAAGTAGCTTGATGGTTG
GACAAATTTCTTAGTAATAATAACTTGCAAATATTTCGCTGCAGCTCTTATAAGATGAAA
TATTGAAATAAAAGATTGAATAAAGAGAAAGAGGTTCTTAAATTTATTTAATTAAATTAA
AATATTTTGTTTATAATTTTTATTAATAAATAAAATTAGAATTAATCCTAAAGCAAGAAT
TGCTATAAGAAATGAGAGATTTAAAACACTTTTTCTAGAGCAATGTAATTAAATAAATAG
AAGATAAAAATGAATAAATGCAGGGTGAGTGTTAGAAGAGCATTGAAGAAGTTTAAAAAA
AGGTGGAAAATGTTGTTAAAACTATTTTTGATTACATCAAAGATGAAAAGCAAGAGGAAA
AAAAGAAAAACTCTGTAGCATAATCAGACTATGCATAGGATATTTCAGATTTATATAATA
CTGTTAATTCCATTAAAGGAAAATTAGATAAAGAAGGTTTAAATCAATAATTTTAACAAG
ATTTGAATAAAGCTATAAAGATCATATTTAGTAAAATCAACTCTGCAAAAAGATCTGTAA
AAAAACAGATTGTTCAAACAAACATGAGTCTAAGGAATAAAAGGAAAAAGGCAACCTAAA
CTTAAAATAATTGA