Identifiers and Description

Gene Model Identifier

TTHERM_00696940

Standard Name

PARP9 (Poly(ADP-Ribosyl) transferase 9)

Aliases

PreTt17491 | 108.m00143 | 3818.m00678

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00696940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18088.19.997093137033517e-262hypothetical protein (919 aa)
OxytrichaContig13466.0.1.g521.999981404597394e-31Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02717662.9993110246221282e-28pARTg on chromosome: 2 positio
n 860066 to 865156

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00696940(coding)
ATGATTTTGAATAATTTCAATTACCCGAAATAACCAGAAATCTAAAATTAATAACAATAA
CATTAAATACATAAAATAAAAGACTCTTTAGCTTTAAGAGTACTTTTTAATACTAGATAA
AAAGAAATTTAAAATCTTGCAAATATATTTAGATTAACTTATTCTGTAAATGAGTATTAA
GGCTTTATAGAAACATTCAAATTTGATAAAGATAAAGAAAATCAAATGGAAGATAATCCA
AGCTAAGTCTTTATTGAATAGATTGAAATGCTTTTGTAAGATGTTTAAAAAAGTATCAAA
TAAGAAGAATATGAATGCAATGCAGATGAATATGATAAAATAAAAAGAATTATTAAAAAA
AATAAAGCATATCAAACAATTTTAAAATAAGCGGCTTAGATAAAATTTATAAATTTTGAT
AATTCGAATGGAGATCTTTCTACAAATACCTACATGCCAGATGTCTTAAAGAAGTACACT
ATAGATGACTAAATAGCAATTAAGGTTTGTCAAATAAATAAGCCTGATTAGCTAAACTTG
TAATTTTTTGACTATTTTTTGATAAATATGTCATAAAGTGGACTTTTTACTGATTCTTTT
GCATAAAATCTTTATAATTCCAATAAAATATTTAAGCAAAAAATAAAATCAATAAAGCAT
GAAATTGAATAGAATAACTCTCTTTTGATTGATACTTTAAACTTTGATCAAAATGAAGAT
AACAAGCAAAAGTAGGAAATTGATTTTATTTTTGAAGAATAAAGCAAGTCTTAAAAAAGT
TATCCATTAACAATTATAATCCAAACTTCACTAGAAGAAAAGAATTGTATAGCTAATCTT
AAGTTAATTTGGGATCGAGTATTGAAAAATATTTAGAGTAACCGCAAAGGATTTTTCCAA
TTTGGCTTATCTTTACATAATTCGTGTTCTTCGAAATACTTATCATGCATAATATAATTT
TTAAAGGAAAAAATACAAAACCAAAAAGATAACTTCTTTAAACTTCCATCTGAGTTTTGG
ATATTTGTTTCTTAAGGCAATGAAAATAGGGTTATCAATATGATGAATGACCTATTAAAA
AACAAAGATCAAATATTTTAGAATCCAAAAAAAATTTGTTATAACTCTTACTATTCTGGA
AATATAGCAGAAAAAAAGTATTTTTCATAAGAAACAAAAGATATAATAAAAAAAGCTTTA
CAAATTGGACTTGAAGCTGTTCCATTTGTTTTAAACGGTGATGCTGTAACCTTTAATTAA
AATAATCCAAATTTGTTTCCAGGAGTATATGGATTTGGTGCGATGCCAATTATGTCAGCA
CCTGCTGTGTGGAGAAATCCAAAAAGTAAAAAAAAACCAAAAAACGAAGACGTTTATAAA
GACACATTTAGGATAGATCTTTAAAAAATGTAAATGCAAGGAACACTTTAGAATTCTATC
TTTCCCATTTTCGAAGATGGTAATGGATACTCATATTTTAATAATAATACAATGGCCTAA
AAAAAATTAGACTCAGCTCTATCTAAGATGATAAAGATATATAAACTATTGGATATAAAA
TAAATAAGTTATTAAATAAATTTATTAAATAATCAATTCACTTCTACTTTTTGTGAGTTA
AATTTCTCCACAGACACAGTTAAGGTGATTGGAGGACAAAGAACTGATAATAATAAATAA
GCAATTCCTGATTTTAATGCTGAAAGCGCAGACAAAGATGAAGATGATCATGATATGCTA
GAAGAAGATCCTTTGAATGAAGATAAGATAGATATTGAAGAGGAAGAATGGAAAAATAAT
TAAAAGGATATTGTGTACTAGAGACCTAAAATCGTTGTAAGGGGTAATCAAGAATGTATC
AACTTAATAGGATGTATTTTAAAAGATATTGAATAAGACAAGTACATATTACATGAGATT
AAAATTAGCTCAAACATCCCTAAAGGTATCACAAAACTTTTTACTTAACTTGAAAATCTA
TACAAAGTGTGGATATATGTAGGGAATCAATCTATTACAATATAAGGCTACCGTAAAACT
TTGAACAATATTTTACCTTTAATTTACAAAGCAGTTTTAGAAATTCCTTAAGACTAAAAG
CAAGAAAAAGAAGATTTGTAGATTGAGTTGGGAATGCCTAAACACTGGGAAAAATAAGAT
GATAATCTAAAATTAGTAACAATCAACTTAAACTCAGATGAAGCTAAAAAAGTTATACAA
CTTTTCTAAAATTCGATGCAAAACATGCCAATTACCAAAATAGAAAGAATCTAAAATATA
AGCTTAATGAAAAATTATCTTTTTGAAAAATAAAAACTTAAAGAAAAGGGAGATGCTACT
GAAAAGTGGTTATTCCATGGAACACGCGCTACACATCCCTCAGTCATTTATAGCAGTCCA
GAATAAGGTTTTGATTTTAGATTGGGATAAGGTGGCATGTATGGAAAAGGTACTTACTTT
CATGATGATGCTTCTTACTCTCATAGCTTTAAATATACTACTCCTTAAAATAAAAGCTAA
ATGTTTCTCGCAGCAGTCTTGGTTGGAAGATGTATTGCTCAACCCCCTAATGCATTTGTA
GCACCTCCTTTTTATAACTAGGCTAAAGGCATCAGGTATGATTCAGTTAGGTGTATGGGT
GCTTATGGTCATAATCAATATATTGTCTATCACAATTCTAAATCTTATCCTCTCTATTTG
ATCACTTATTGA


>TTHERM_00696940(protein)
MILNNFNYPKQPEIQNQQQQHQIHKIKDSLALRVLFNTRQKEIQNLANIFRLTYSVNEYQ
GFIETFKFDKDKENQMEDNPSQVFIEQIEMLLQDVQKSIKQEEYECNADEYDKIKRIIKK
NKAYQTILKQAAQIKFINFDNSNGDLSTNTYMPDVLKKYTIDDQIAIKVCQINKPDQLNL
QFFDYFLINMSQSGLFTDSFAQNLYNSNKIFKQKIKSIKHEIEQNNSLLIDTLNFDQNED
NKQKQEIDFIFEEQSKSQKSYPLTIIIQTSLEEKNCIANLKLIWDRVLKNIQSNRKGFFQ
FGLSLHNSCSSKYLSCIIQFLKEKIQNQKDNFFKLPSEFWIFVSQGNENRVINMMNDLLK
NKDQIFQNPKKICYNSYYSGNIAEKKYFSQETKDIIKKALQIGLEAVPFVLNGDAVTFNQ
NNPNLFPGVYGFGAMPIMSAPAVWRNPKSKKKPKNEDVYKDTFRIDLQKMQMQGTLQNSI
FPIFEDGNGYSYFNNNTMAQKKLDSALSKMIKIYKLLDIKQISYQINLLNNQFTSTFCEL
NFSTDTVKVIGGQRTDNNKQAIPDFNAESADKDEDDHDMLEEDPLNEDKIDIEEEEWKNN
QKDIVYQRPKIVVRGNQECINLIGCILKDIEQDKYILHEIKISSNIPKGITKLFTQLENL
YKVWIYVGNQSITIQGYRKTLNNILPLIYKAVLEIPQDQKQEKEDLQIELGMPKHWEKQD
DNLKLVTINLNSDEAKKVIQLFQNSMQNMPITKIERIQNISLMKNYLFEKQKLKEKGDAT
EKWLFHGTRATHPSVIYSSPEQGFDFRLGQGGMYGKGTYFHDDASYSHSFKYTTPQNKSQ
MFLAAVLVGRCIAQPPNAFVAPPFYNQAKGIRYDSVRCMGAYGHNQYIVYHNSKSYPLYL
ITY


>TTHERM_00696940(gene)
ATGATTTTGAATAATTTCAATTACCCGAAATAACCAGAAATCTAAAATTAATAACAATAA
CATTAAATACATAAAATAAAAGACTCTTTAGCTTTAAGAGTACTTTTTAATACTAGATAA
AAAGAAATTTAAAATCTTGCAAATATATTTAGATTAACTTATTCTGTAAATGAGTATTAA
GGCTTTATAGAAACATTCAAATTTGATAAAGATAAAGAAAATCAAATGGAAGATAATCCA
AGCTAAGTCTTTATTGAATAGATTGAAATGCTTTTGTAAGATGTTTAAAAAAGTATCAAA
TAAGAAGAATATGAATGCAATGCAGATGAATATGATAAAATAAAAAGAATTATTAAAAAA
AATAAAGCATATCAAACAATTTTAAAATAAGCGGCTTAGATAAAATTTATAAATTTTGAT
AATTCGAATGGAGATCTTTCTACAAATACCTACATGCCAGATGTCTTAAAGAAGTACACT
ATAGATGACTAAATAGCAATTAAGGTTTGTCAAATAAATAAGCCTGATTAGCTAAACTTG
TAATTTTTTGACTATTTTTTGATAAATATGTCATAAAGTGGACTTTTTACTGATTCTTTT
GCATAAAATCTTTATAATTCCAATAAAATATTTAAGCAAAAAATAAAATCAATAAAGCAT
GAAATTGAATAGAATAACTCTCTTTTGATTGATACTTTAAACTTTGATCAAAATGAAGAT
AACAAGCAAAAGTAGGAAATTGATTTTATTTTTGAAGAATAAAGCAAGTCTTAAAAAAGT
TATCCATTAACAATTATAATCCAAACTTCACTAGAAGAAAAGAATTGTATAGCTAATCTT
AAGTTAATTTGGGATCGAGTATTGAAAAATATTTAGAGTAACCGCAAAGGATTTTTCCAA
TTTGGCTTATCTTTACATAATTCGTGTTCTTCGAAATACTTATCATGCATAATATAATTT
TTAAAGGAAAAAATACAAAACCAAAAAGATAACTTCTTTAAACTTCCATCTGAGTTTTGG
ATATTTGTTTCTTAAGGCAATGAAAATAGGGTTATCAATATGATGAATGACCTATTAAAA
AACAAAGATCAAATATTTTAGAATCCAAAAAAAATTTGTTATAACTCTTACTATTCTGGA
AATATAGCAGAAAAAAAGTATTTTTCATAAGAAACAAAAGATATAATAAAAAAAGCTTTA
CAAATTGGACTTGAAGCTGTTCCATTTGTTTTAAACGGTGATGCTGTAACCTTTAATTAA
AATAATCCAAATTTGTTTCCAGGAGTATATGGATTTGGTGCGATGCCAATTATGTCAGCA
CCTGCTGTGTGGAGAAATCCAAAAAGTAAAAAAAAACCAAAAAACGAAGACGTTTATAAA
GACACATTTAGGATAGATCTTTAAAAAATGTAAATGCAAGGAACACTTTAGAATTCTATC
TTTCCCATTTTCGAAGATGGTAATGGATACTCATATTTTAATAATAATACAATGGCCTAA
AAAAAATTAGACTCAGCTCTATCTAAGATGATAAAGATATATAAACTATTGGATATAAAA
TAAATAAGTTATTAAATAAATTTATTAAATAATCAATTCACTTCTACTTTTTGTGAGTTA
AATTTCTCCACAGACACAGTTAAGGTGATTGGAGGACAAAGAACTGATAATAATAAATAA
GCAATTCCTGATTTTAATGCTGAAAGCGCAGACAAAGATGAAGATGATCATGATATGCTA
GAAGAAGATCCTTTGAATGAAGATAAGATAGATATTGAAGAGGAAGAATGGAAAAATAAT
TAAAAGGATATTGTGTACTAGAGACCTAAAATCGTTGTAAGGGGTAATCAAGAATGTATC
AACTTAATAGGATGTATTTTAAAAGATATTGAATAAGACAAGTACATATTACATGAGATT
AAAATTAGCTCAAACATCCCTAAAGGTATCACAAAACTTTTTACTTAACTTGAAAATCTA
TACAAAGTGTGGATATATGTAGGGAATCAATCTATTACAATATAAGGCTACCGTAAAACT
TTGAACAATATTTTACCTTTAATTTACAAAGCAGTTTTAGAAATTCCTTAAGACTAAAAG
CAAGAAAAAGAAGATTTGTAGATTGAGTTGGGAATGCCTAAACACTGGGAAAAATAAGAT
GATAATCTAAAATTAGTAACAATCAACTTAAACTCAGATGAAGCTAAAAAAGTTATACAA
CTTTTCTAAAATTCGATGCAAAACATGCCAATTACCAAAATAGAAAGAATCTAAAATATA
AGCTTAATGAAAAATTATCTTTTTGAAAAATAAAAACTTAAAGAAAAGGGAGATGCTACT
GAAAAGTGGTTATTCCATGGAACACGCGCTACACATCCCTCAGTCATTTATAGCAGTCCA
GAATAAGGTTTTGATTTTAGATTGGGATAAGGTGGCATGTATGGAAAAGGTACTTACTTT
CATGATGATGCTTCTTACTCTCATAGCTTTAAATATACTACTCCTTAAAATAAAAGCTAA
ATGTTTCTCGCAGCAGTCTTGGTTGGAAGATGTATTGCTCAACCCCCTAATGCATTTGTA
GCACCTCCTTTTTATAACTAGGCTAAAGGCATCAGGTATGATTCAGTTAGGTGTATGGGT
GCTTATGGTCATAATCAATATATTGTCTATCACAATTCTAAATCTTATCCTCTCTATTTG
ATCACTTATTGA