Identifiers and Description

Gene Model Identifier

TTHERM_00006070

Standard Name

PARP8 (Poly(ADP-Ribosyl) transferase 8)

Aliases

PreTt11615 | 1.m00663

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00180 ) ParB-like partition proteins
  • ( PF08455 ) Bacterial SNF2 helicase associated
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00006070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02907.19.997093137033517e-262hypothetical protein (1015 aa)
OxytrichaContig11469.0.g1054.000054831110256e-33Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02717669.996273942859018e-26pARTg on chromosome: 2 positio
n 860066 to 865156

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00006070(coding)
ATGGATAGCTCCCCTTTAAATATTTAGAGAGTTTCACAATAAATGTTTGAAATTGATGAT
CCTTTTATATTGATGATGATATAAAAAGATAATCAGAAAGAAATTCAAAATTTAGAGTAA
AAGTATCAAATTAAGATATAAATAAACTAGGGATATGGTCAAGTGCATATTTTACAATAA
GAAGACAGTATTGAAGAACATTTGGACTAGTCTATAGTTGATTCTATTGAAAAGCACTTT
AATAATTTTGAAAAAGTTCAAAAAAAGAAAGTTACTGAGTAGTATGTAGAATGCAATAGA
GACTTTTACTTGAAGCTCAATAAAGTTCTTTAGAAATATCATACAAAATTATAATAATAT
CATTTAGATTTTATTGGAAATGAATCACAATAAGATTATGATTAAAATAAAATATACTAA
CCCCTTGTCGTGAAAAGCATCCAAATTCAAGATAAATTCCTAATCTAAACTTGCAAGATC
GAATAGCCAGAATATCTAAATTTTGAAGAAATAGATGTATTAGTGTTAAACATGACACAA
TAAGGATTGTTTGTAGATGATTTTGGTTATCAATTAGTTAATTCGAATCCAGGTCTCAAA
TAGCTTATCAAATAGTTGAAATAGTAAATTAAGACATCCAACTTTATTGATGAGCATGTC
TTTTACCAAGGAAAAAAAGCAATAAGTCTACTTATACAATTACAAGAGGACGAAAAGGTG
TGCATTGATAACTTGCAAGTAATTCTTAACAAATTGAAAGAATAGAAATATAAATAAAAG
GGGCATTTAAGAATTTCTGTTGCTATAAGAGAATGCTGTGGAAAGAAATATGTTGAAGCT
TTTGGCTCCTACATAAAATAAGCGATTAAGCAAAAATCATATTTGAATTTTCCATCAGAA
ATAAATTTTATTGTGAACGAAAGAAATGAAAATTTAATTTCTTAGTAGTTAGATAATTTA
AAAAAGATAGAGTTAAATGAAAAAGAAAAGCTCGGTCTCCTCTCTTTATTTACTTCAAAA
TCCAAAAAAAGCCAAAAAGAAGATAAAATGTGGGTTGAAGAAAGCATTTAATCTTCTCTT
CTTCGTATTCAAGGTAAAGGCACAGAAGTTGAAGAAATAGTGAAAATTTTTAAAAAGCTT
TAGTAAGATTGTTTTATCAGATTTGAATTACCTTTAAACAACGGAAGCCTTACTGAAGAG
CTTGTTAAATATTTATAAGAAATAGCTATTAAATAAACAATGAGCATAGAAATCAGTGAA
AAAAGTGTTAGCATATATGCTTACAAAAAGACTATCAACAAATTTCTACCAATCATAGCT
AACTAAATCAGAGGAAGCTAAACGATGCTAAGAATTTAGTGCTAAGTACCTCCAAACTGG
TCTAACTAAAGAGAGAATCTTTTGCTTGTAAACCTTGATCTTTCAAGTCCTGAAGCCATG
GATTGTATAACAGCAATGAAAAAAACATTGCCTAATTCAAAAGTAAGCAGGATACAAAGA
GTATAGAATATAAAATTATGGAGAAATTATATGTATGAAAAATAAAAACTTGTTTAGAAA
GGAAATGCAAAAGAACTACTCTTGTTTCATGGTACAAGAAATAATAAACCTGAAATGATA
TATAATGGAACAGAAGAAGGGTTTGATTTTAGACTAAGTGCTCACGGTATGTATGGTAGA
GGTACTTATTTTCATGAAATGGCATCTTATTCTGATGGATACGCTTATCATGATGGATCC
AAAAAAGTCTTCTTTCTTGCTTAAGTCCTAGTAGGCAATTACTATGTTGGTGGAAGTAGC
GGCTATGTTTCTCCTCCAATTATCCCAGGTACAAACGGATTAAGATATGATTCAATTAGA
TCGAATTATAATGAAGGATAGAACATGTTTATCATTTATCATAATTCAAAAGCATATCCT
ACTTATCTTATTGATTATAATTGA


>TTHERM_00006070(protein)
MDSSPLNIQRVSQQMFEIDDPFILMMIQKDNQKEIQNLEQKYQIKIQINQGYGQVHILQQ
EDSIEEHLDQSIVDSIEKHFNNFEKVQKKKVTEQYVECNRDFYLKLNKVLQKYHTKLQQY
HLDFIGNESQQDYDQNKIYQPLVVKSIQIQDKFLIQTCKIEQPEYLNFEEIDVLVLNMTQ
QGLFVDDFGYQLVNSNPGLKQLIKQLKQQIKTSNFIDEHVFYQGKKAISLLIQLQEDEKV
CIDNLQVILNKLKEQKYKQKGHLRISVAIRECCGKKYVEAFGSYIKQAIKQKSYLNFPSE
INFIVNERNENLISQQLDNLKKIELNEKEKLGLLSLFTSKSKKSQKEDKMWVEESIQSSL
LRIQGKGTEVEEIVKIFKKLQQDCFIRFELPLNNGSLTEELVKYLQEIAIKQTMSIEISE
KSVSIYAYKKTINKFLPIIANQIRGSQTMLRIQCQVPPNWSNQRENLLLVNLDLSSPEAM
DCITAMKKTLPNSKVSRIQRVQNIKLWRNYMYEKQKLVQKGNAKELLLFHGTRNNKPEMI
YNGTEEGFDFRLSAHGMYGRGTYFHEMASYSDGYAYHDGSKKVFFLAQVLVGNYYVGGSS
GYVSPPIIPGTNGLRYDSIRSNYNEGQNMFIIYHNSKAYPTYLIDYN


>TTHERM_00006070(gene)
ATGGATAGCTCCCCTTTAAATATTTAGAGAGTTTCACAATAAATGTTTGAAATTGATGAT
CCTTTTATATTGATGATGATATAAAAAGATAATCAGAAAGAAATTCAAAATTTAGAGTAA
AAGTATCAAATTAAGATATAAATAAACTAGGGATATGGTCAAGTGCATATTTTACAATAA
GAAGACAGTATTGAAGAACATTTGGACTAGTCTATAGTTGATTCTATTGAAAAGCACTTT
AATAATTTTGAAAAAGTTCAAAAAAAGAAAGTTACTGAGTAGTATGTAGAATGCAATAGA
GACTTTTACTTGAAGCTCAATAAAGTTCTTTAGAAATATCATACAAAATTATAATAATAT
CATTTAGATTTTATTGGAAATGAATCACAATAAGATTATGATTAAAATAAAATATACTAA
CCCCTTGTCGTGAAAAGCATCCAAGTAAAACTTTTCTAATGATATCAATTAAAATAAATA
CCTTTTTAACTATTCTTAAAAATAAAACCTTTATTTTAAAACCTTTCTATTTAATATTAA
AGATTCAAGATAAATTCCTAATCTAAACTTGCAAGATCGAATAGCCAGAATATCTAAATT
TTGAAGAAATAGATGTATTAGTGTTAAACATGACACAATAAGGATTGTTTGTAGATGATT
TTGGTTATCAATTAGTTAATTCGAATCCAGGTCTCAAATAGCTTATCAAATAGTTGAAAT
AGTAAATTAAGACATCCAACTTTATTGATGAGCATGTCTTTTACCAAGGAAAAAAAGTAA
CTTTTTAGACAAAAATATGTTTATGTGTGTATGTGTTTAAGGTTTAGTTTGTTTCAATTT
TATTAAATATAAATAGGCAATAAGTCTACTTATACAATTACAAGAGGACGAAAAGGTGTG
CATTGATAACTTGCAAGTAATTCTTAACAAATTGAAAGAATAGAAATATAAATAAAAGGG
GCATTTAAGAATTTCTGTTGCTATAAGAGAATGCTGTGGAAAGAAATATGTTGAAGCTTT
TGGCTCCTACATAAAATAAGCGATTAAGCAAAAATCATATTTGAATTTTCCATCAGAAAT
AAATTTTATTGTGAACGAAAGAAATGAAAATTTAATTTCTTAGTAGTTAGATAATTTAAA
AAAGATAGAGTTAAATGAAAAAGAAAAGCTCGGTCTCCTCTCTTTATTTACTTCAAAATC
CAAAAAAAGCCAAAAAGAAGATAAAATGTGGGTTGAAGAAAGCATTTAATCTTCTCTTCT
TCGTATTCAAGGTAAAGGCACAGAAGTTGAAGAAATAGTGAAAATTTTTAAAAAGCTTTA
GTAAGATTGTTTTATCAGATTTGAATTACCTTTAAACAACGGAAGCCTTACTGAAGAGCT
TGTTAAATATTTATAAGAAATAGCTATTAAATAAACAATGAGCATAGAAATCAGTGAAAA
AAGTGTTAGCATATATGCTTACAAAAAGACTATCAACAAATTTCTACCAATCATAGCTAA
CTGTAATTAAATTCTTATTTAAAATCATTTTTGTACCTAACTTTATTATTAAATAATCTA
ACTTTAAAAGAAATCAGAGGAAGCTAAACGATGCTAAGAATTTAGTGCTAAGTACCTCCA
AACTGGTCTAACTAAAGAGAGAATCTTTTGCTTGTAAACCTTGATCTTTCAAGTCCTGAA
GCCATGGATTGTATAACAGCAATGAAAAAAACATTGCCTAATTCAAAAGTAAGCAGGATA
CAAAGAGTATAGAATATAAAATTATGGAGAAATTATATGTATGAAAAATAAAAACTTGTT
TAGAAAGGAAATGCAAAAGAACTACTCTTGTTTCATGGTACAAGAAATAATAAACCTGAA
ATGATATATAATGGAACAGAAGAAGGGTTTGATTTTAGGTAATTTACTAATTTATTAATT
AATTGATTGATTTCTTTGTGAGTTAATAATTCAAATTATAATAGCATAAGATAAAATGAA
ATTTAACAAAGCAATAATTTTGCTAAAAAAAGACAAATTTATTTAAAAAAAGATCAAAAT
TCTACATTAAATAACAATCAATTTGCAGATATCTACATAAGTTAAATCTTTATCTCCCAT
TTTCAGGATAGTTATTCATCTATTTACTCAATATAAAACATCAACTTTTATAAATAAGAT
GATAAAAAAAAATAATTTTATTTTCAAATTTAATTTTGAAGCTGTGTTTTTACATTTTAA
TTCTTTTTAAACCAGAATTTTTAGACATCTTTTAAAACTGTAAATAGATAGGATGATTAT
TATACTGTAATAAGGATTTATATTAATTAGCTGACATAGATCTTTAGAAATTGAAATTAA
AAAAGTATATTTTTTTATAAAAAAGACTAAGTGCTCACGGTATGTATGGTAGAGGTACTT
ATTTTCATGAAATGGCATCTTATTCTGATGGATACGCTTATCATGATGGATCCAAAAAAG
TCTTCTTTCTTGCTTAAGTCCTAGTAGGCAATTACTATGTTGGTGGAAGTAGCGGCTATG
TTTCTCCTCCAATTATCCCAGGTACAAACGGATTAAGATATGATTCAATTAGATCGAATT
ATAATGAAGGATAGAACATGTTTATCATTTATCATAATTCAAAAGCATATCCTACTTATC
TTATTGATTATAATTGA