Identifiers and Description

Gene Model Identifier

TTHERM_00006060

Standard Name

PARP7 (Poly(ADP-Ribosyl) transferase 7)

Aliases

PreTt11614 | 1.m00662

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00127 ) isocitrate dehydrogenase, NADP-dependent
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00006060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02908.19.997093137033517e-262hypothetical protein (847 aa)
OxytrichaContig12732.0.g622.99851380290819e-19Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02717668.997498379799854e-17pARTg on chromosome: 2 positio
n 860066 to 865156

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00006060(coding)
ATGGATTCTAATTAGGGATAGAATTAAGTATCTGAAGATAAAAGCTTGTTTACTGTTATT
GATAGATTTGCTCTAAACTTGGTCAAGTAAAATTTCTAAAGATAGATAGCAGAGATTGAA
AACCAGTTTAAAGTTTCCATTACTATAATTGAAGAATATGGTTAAGTTTTAATTAAGAGA
ACTAGTGATGAAGTTAGTACACCTGAATTGGAAAAAGAGTTGTTTTAATAAGTAGGCTAT
AAAGTACTTGAGCTAACTATTATTCAATCTAGCAAACTCAAGGAAGGTAAGATTGATAGC
AATAGTGAGTTTTATCTTAAAATTGAAAAGAATCTTAAAAAGAAATATGAAAGTTTGAAC
AGAAAGTAAGATTATGAAATCTCTTTATAGACTAATGATATTGATTAAAATTTCTCATCA
TCCAAGAAGTATAAACCTTTAGTCCTCAAGTCGTTGAATATAAAAGGTAAATTTGTGGTA
AAGATATGCAAGATAGAGTAGCCAGAAAACTTAAATTTCGATAAAATCGATGTTGTCGTA
CTAAATATGACAAAAACAGGTATATACCTTGACGAATTCGGGTACTAGTTAGTTAAATCT
AATAATCAATTGAACTTGCTACTTAAGTCTCTTAAGCAGCAAATTTAACATTCTGACTAT
ATTGACGAAAAAGTATTTTTAGTAGGCAGCAAAAATATTAGTTTAATAATACAATTTGAA
GACAATGAAGATGCCTGTATAAATCGTTTACTTTAAATACTTGATAAGCTCAAAGATTAG
AAGTTCTAATAAAAAGGCAACTTACGTATTTTTATAGGGTGGAGACCTTGCTGTGGATAG
AAATATTTTGAAACCCTTTACAAGTATTTGGAAAAATTAGATTCTAGTAAAACTTATCTT
TAGTTTCCCACAGAAATTTGCCTAGTGACTGATGAAGGATTGGAAAATCAAGTATTGCAA
GTTGTTTAAACTGTTTAATTCAATTAAACTGTAAGCGGAAAAATAGAAATGAAAAAAGAA
GTCTTATGGAATATAAATACTGAAAAATATCCAAGATTTGTTGATTAAAATGTATAATTA
CCAGGTATCGTTTTAGGAAAAGAGCTTACCGAAATGATTGAAAAAGCAACTGAGCTAAAG
CAAGAAGAGTTTTATTGTGCACTGAAGCTTGATGGGTAGGAAAAGTAATTTTTCTAAACT
CCAAAGGAATTAGGTATGAATCCTGAAATAGTAGATAGGTTAAAACTAAATTTAAAAGCA
TTAAAGGAAACTAACTTATCATAAAGCTGCACCAACTAAATTCTTAACCAGTGTGACTTC
TATTACTATCTCCACCCTTATGAAGAAGATTACAAAATGTATCCAGAAGATGTGCAAAAC
GTCATAAGATCTTATGTAAAGTTAGGATTTTTTGAACTAAGATTGGAGAGAGACTCCTGC
ACGATGGATATAATTACTCCAATTTTTAAGATAAACATTAAGTAGTTAACGATGCAATAG
ATTTAGGGGAATAAGAAATTGGTTTATTTGAAAAGATAAGAGAAATAAGTTTAAGTTATG
AATACTGAATAGAAATAGGCATATGATGAGATTATGAAAATAAATGTGCTCTAATTTTTG
TAGAGTGATCAAGCTGAAAAAGCCTAAGACTTAACTTTGAAGTCGAAGCCTTATATTTAT
GTAAGGGCAAAACCTGAAACTTATGATGAAATAAGCTAATTTATAACTTAATTAAAACTA
AATTCATTTGTTACTCATCACATCAAAATAAACTAACAAAATTTAAACACAGTAGTAAAA
TAATATTTAGAATAAACTTCTCTGATAGAAAATGTAGAAATCAGCATTGTTGACGATATC
TTGCTGATATATGGCTTTAAAAAGACTTTGAATAGGATTTTACCAGCTTTGATGAGCAAG
GTTTGCGATAGCAAGTATGGCGAAGAATCTGTTTACGCAATTCCTTCATTTTGGGAACCT
TAAAATAATAACCATCTTTTATTCAGCCTCAGCTTGAACTCTGTAGAAGCAGTAAAATGT
ATAAATATGTTTAATCAAAGTATGTCAAATATTGTGAGAAAGGTGTACAGAATCCAAAAT
ATGAATTTATGGAAAAACTATTAATTTGAAAAAGAAACTCTTCTTTAAAAAGGTAATGCA
AGCGAAAGACTTCTTTTCCATGGACCAGGTGTTAACGTCAATCCAGAAACAATTTACACA
GCTATCGAAGAAGGTTTTGATTTTAGAAATGACTCTATTTAAAATGGATAAATTTTTGGT
AGAGGAGCTCATTTCCATGACTAAGCTAGTAAAGCAAACCAATATGCTTATATAACAAGT
GGTAAAAGATAAATAATTATTGCAAGTGTCCTTATTGGTAAAGCTTTCGAGACATCATCA
AATGCTTCTTATACAAAGCCTCCAGTTATCACTGAAGGAAAAGAATAAAGATATGACTCA
GTCAAATCAAATAATTAAGAAGGCAATAATACTTATGCTGTTTACCACAACTCAAAGGCA
TATCCTTATTACTTATTAGAATATGATTGA


>TTHERM_00006060(protein)
MDSNQGQNQVSEDKSLFTVIDRFALNLVKQNFQRQIAEIENQFKVSITIIEEYGQVLIKR
TSDEVSTPELEKELFQQVGYKVLELTIIQSSKLKEGKIDSNSEFYLKIEKNLKKKYESLN
RKQDYEISLQTNDIDQNFSSSKKYKPLVLKSLNIKGKFVVKICKIEQPENLNFDKIDVVV
LNMTKTGIYLDEFGYQLVKSNNQLNLLLKSLKQQIQHSDYIDEKVFLVGSKNISLIIQFE
DNEDACINRLLQILDKLKDQKFQQKGNLRIFIGWRPCCGQKYFETLYKYLEKLDSSKTYL
QFPTEICLVTDEGLENQVLQVVQTVQFNQTVSGKIEMKKEVLWNINTEKYPRFVDQNVQL
PGIVLGKELTEMIEKATELKQEEFYCALKLDGQEKQFFQTPKELGMNPEIVDRLKLNLKA
LKETNLSQSCTNQILNQCDFYYYLHPYEEDYKMYPEDVQNVIRSYVKLGFFELRLERDSC
TMDIITPIFKINIKQLTMQQIQGNKKLVYLKRQEKQVQVMNTEQKQAYDEIMKINVLQFL
QSDQAEKAQDLTLKSKPYIYVRAKPETYDEISQFITQLKLNSFVTHHIKINQQNLNTVVK
QYLEQTSLIENVEISIVDDILLIYGFKKTLNRILPALMSKVCDSKYGEESVYAIPSFWEP
QNNNHLLFSLSLNSVEAVKCINMFNQSMSNIVRKVYRIQNMNLWKNYQFEKETLLQKGNA
SERLLFHGPGVNVNPETIYTAIEEGFDFRNDSIQNGQIFGRGAHFHDQASKANQYAYITS
GKRQIIIASVLIGKAFETSSNASYTKPPVITEGKEQRYDSVKSNNQEGNNTYAVYHNSKA
YPYYLLEYD


>TTHERM_00006060(gene)
ATGGATTCTAATTAGGGATAGAATTAAGTATCTGAAGATAAAAGCTTGTTTACTGTTATT
GATAGATTTGCTCTAAACTTGGTCAAGTAAAATTTCTAAAGATAGATAGCAGAGATTGAA
AACCAGTTTAAAGTTTCCATTACTATAATTGAAGAATATGGTTAAGTTTTAATTAAGAGA
ACTAGTGATGAAGTTAGTACACCTGAATTGGAAAAAGAGTTGTTTTAATAAGTAGGCTAT
AAAGTACTTGAGCTAACTATTATTCAATCTAGCAAACTCAAGGAAGGTAAGATTGATAGC
AATAGTGAGTTTTATCTTAAAATTGAAAAGAATCTTAAAAAGAAATATGAAAGTTTGAAC
AGAAAGTAAGATTATGAAATCTCTTTATAGACTAATGATATTGATTAAAATTTCTCATCA
TCCAAGAAGTATAAACCTTTAGTCCTCAAGTCGTTGAATGTAAAATTTTTTTTTAAATTA
TAATTTCAATGTAAATTGACTTTAAATAATTATTTTGTTTAGATAAAAGGTAAATTTGTG
GTAAAGATATGCAAGATAGAGTAGCCAGAAAACTTAAATTTCGATAAAATCGATGTTGTC
GTACTAAATATGACAAAAACAGGTATATACCTTGACGAATTCGGGTACTAGTTAGTTAAA
TCTAATAATCAATTGAACTTGCTACTTAAGTCTCTTAAGCAGCAAATTTAACATTCTGAC
TATATTGACGAAAAAGTATTTTTAGTAGGCAGCAAAGTAAGTTTCTTTTTTAATGGTGAA
ATAACTCTTAAAAGCAATTTTATTTAATACTAAAAGAATATTAGTTTAATAATACAATTT
GAAGACAATGAAGATGCCTGTATAAATCGTTTACTTTAAATACTTGATAAGCTCAAAGAT
TAGAAGTTCTAATAAAAAGGCAACTTACGTATTTTTATAGGGTGGAGACCTTGCTGTGGA
TAGAAATATTTTGAAACCCTTTACAAGTATTTGGAAAAATTAGATTCTAGTAAAACTTAT
CTTTAGTTTCCCACAGAAATTTGCCTAGTGACTGATGAAGGATTGGAAAATCAAGTATTG
CAAGTTGTTTAAACTGTTTAATTCAATTAAACTGTAAGCGGAAAAATAGAAATGAAAAAA
GAAGTCTTATGGAATATAAATACTGAAAAATATCCAAGATTTGTTGATTAAAATGTATAA
TTACCAGGTATCGTTTTAGGAAAAGAGCTTACCGAAATGATTGAAAAAGCAACTGAGCTA
AAGCAAGAAGAGTTTTATTGTGCACTGAAGCTTGATGGGTAGGAAAAGTAATTTTTCTAA
ACTCCAAAGGAATTAGGTATGAATCCTGAAATAGTAGATAGGTTAAAACTAAATTTAAAA
GCATTAAAGGAAACTAACTTATCATAAAGCTGCACCAACTAAATTCTTAACCAGTGTGAC
TTCGTAAAAGAATTCATTTTATAATTAAATTATTTTTATTTATTAATTTGTTTGTTTGTT
AAAAAGTATTACTATCTCCACCCTTATGAAGAAGATTACAAAATGTATCCAGAAGATGTG
CAAAACGTCATAAGATCTTATGTAAAGTTAGGATTTTTTGAACTAAGATTGGAGAGAGAC
TCCTGCACGATGGATATAATTACTCCAATTTTTAAGATAAACATTAAGTAGTTAACGATG
CAATAGATTTAGGGGAATAAGAAATTGGTTTATTTGAAAAGATAAGAGAAATAAGTTTAA
GTTATGAATACTGAATAGAAATAGGCATATGATGAGATTATGAAAATAAATGTGCTCTAA
TTTTTGTAGAGTGATCAAGCTGAAAAAGCCTAAGACTTAACTTTGAAGTCGAAGCCTTAT
ATTTATGTAAGGGCAAAACCTGAAACTTATGATGAAATAAGCTAATTTATAACTTAATTA
AAACTAAATTCATTTGTTACTCATCACATCAAAATAAACTAACAAAATTTAAACACAGTA
GTAAAATAATATTTAGAATAAACTTCTCTGATAGAAAATGTAGAAATCAGCATTGTTGAC
GATATCTTGCTGATATATGGCTTTAAAAAGACTTTGAATAGGATTTTACCAGCTTTGATG
AGCAGTATGATTTATTCAAATTAATTAATCATTTATTTATTTTAAACTTTTAAATTATTA
TTAAACAGAGGTTTGCGATAGCAAGTATGGCGAAGAATCTGTTTACGCAATTCCTTCATT
TTGGGAACCTTAAAATAATAACCATCTTTTATTCAGCCTCAGCTTGAACTCTGTAGAAGC
AGTAAAATGTATAAATATGTTTAATCAAAGTATGTCAAATATTGTGAGAAAGGTGTACAG
AATCCAAAATATGAATTTATGGAAAAACTATTAATTTGAAAAAGAAACTCTTCTTTAAAA
AGGTAATGCAAGCGAAAGACTTCTTTTCCATGGACCAGGTGTTAACGTCAATCCAGAAAC
AATTTACACAGCTATCGAAGAAGGTTTTGATTTTAGGTAAAAATTATTTTTAGAAATATT
TTATTTATTTTATTAACTTTTAATATAATAAAGAAATGACTCTATTTAAAATGGATAAAT
TTTTGGTAGAGGAGCTCATTTCCATGACTAAGCTAGTAAAGCAAACCAATATGCTTATAT
AACAAGTGGTAAAAGATAAATAATTATTGCAAGTGTCCTTATTGGTAAAGCTTTCGAGAC
ATCATCAAATGCTTCTTATACAAAGCCTCCAGTTATCACTGAAGGAAAAGAATAAAGATA
TGACTCAGTCAAATCAAATAATTAAGAAGGCAATAATACTTATGCTGTTTACCACAACTC
AAAGGCATATCCTTATTACTTATTAGAATATGATTGA