Identifiers and Description

Gene Model Identifier

TTHERM_00502600

Standard Name

PARP6 (Poly [ADP-Ribose] Polymerase 6)

Aliases

PreTt08099 | 63.m00277 | 3716.m00129

Description

PARP6 WGR domain protein; WGR domain containing protein; abundant protein associated with RNA polymerase II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF05406 ) WGR domain
  • ( PF02178 ) AT hook motif
  • ( PF00023 ) Ankyrin repeat
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF09151 ) Domain of unknown function (DUF1936)
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( PF02877 ) Poly(ADP-ribose) polymerase, regulatory domain
  • ( PF04086 ) Signal recognition particle, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00502600

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01738 ) Micronucleus: PAR1 gene partially replaced by neo4-KanR2 cassette.
  • ( SD01783 ) Micronucleus: GCP3 gene partially replaced by neo4-KanR2 cassette.

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09552.19.997093137033517e-262WGR domain-containing protein
(2622 aa)
OxytrichaContig20797.0.g563.001476460448119e-154Ankyrin repeats (3 copies)
DictyBaseDDB_G02917889.99679536751975e-103adprt3 on chromosome: 6 positi
on 795337 to 803296
WormBaseWBGene000040536.997942222381785e-66locus:pme-5 Poly(ADP-ribose)
polymerase pme-5 status:Par
tially_confirmed UniProt:Q9T
XQ1 protein_id:CCD69563.1
Stentor CoeruleusSteCoe_332751.1379798735078682e-50
SGDYIL112W0.000000000010004361180063202HOS4 Subunit of the Set3 compl
ex, which is a meiotic-specifi
c repressor of sporulation spe
cific genes that contains deac
etylase activity; potential Cd
c28p substrate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00502600(coding)
ATGGCTGATAAAGGAATTTTTATTTACGCAGTCAGAGATGAAGACAGCATGCAAGGCTTC
ATCTTGGTTGCTAGTGAGGTAGATATTGATGTGGAAAACTCTAAGGCAGAGAAGGTTGGA
GTTTACCATATTCATTCTGTAAAAAATAAACCATACAATTATACAGTCAACAAAAAACTC
ACTAATGTAAGACTTGATGAGTTTATGAGCGTAGTAGATGAGGATTTATATGAGTTTAAT
GAAAAGAATAGAACTCTAGTATTCGATAAGAAAGGTTATGACAACTTAATTGGTTAACTT
ATGGATGATTTAGAAGAAGAAAATGATGATGACTCATCAGAAGAAGAAGAAAAAAAAAAG
AAGAAACCTGCTCCTAAGGCAGCTTCTGCCAGGAAAACTCGTAGTTCTAAGGGATCTGAT
AAGGTTAAGGGATCTGACAGTGAAAGCTATGAGGCAGCTGACGAAGAAGATGAAGAAGAA
AAAAAGAGATCAAGAGGAAGACCTAAAAAAAATAAATCCACTGAAGAAATTACAGAAGAT
AAAGACGAAAACTCTTAAGAGGATTAACCTAAGCCTAAAGGAAAAAGAGGAAGACCTCCT
TCTAAGGATAAAGCTGCATCAGTCGCTGTTCCAAAAAAATAGGATAAGTAGGATGATAAA
GATGGAGAAGAAAATGGTGAAGATTAAAATGGTCATGAAGAAAATGGAGATGAAGATAAG
GAAGAAGGAGAGTAAAAACGTGTTCCTGGTAAACGTGGCAGAAAGCCAGGTAAAAAAACA
GCAGAAACACCTGCAAAAAAAGAAGCGTAATAAAATATTATACATAATAGAAAGCCATAA
GTATTTTTAATTTAAAGACCTGGAAAAAGAGGAAGAAAGCCAGCAAAGAAGGGCTCAGAA
TCAGAAGATAATGAAGATGCTGATGATGAATAAGAAGAAGTCTCAAAAAAGGGAGCAAAA
AAGAAAGTAGAAAAATATAAGAAAGGTTCACACAATCCTAATATACCTGATGTAGTCAAA
ACTGACGAAACTTTCGAAGGTGATTCTTAAGATATTAATGACGTTTGTTGCTCATTCTGC
ACAAACAGAGAATTGTTAAGAGCTGTTTACACAGGTAATAGTAATCTTTTGAAAAAATTA
GTTTAGTCAAAAGCAAAGGTCTCTACTTTGTTTGCCAAGAGAGGTCCTGATGCTGATGAA
ACCACACTTGAAATCATTCTTAAAAACAAGGATAAAAAGTGCCTTGATGTTTTGATTAAT
GCTCTTAACAAGAAATCAGAAATTTCTTTAGCTTCTAATCCTGAATGCTCCTTAGAAGAA
GTCTATACTGGTTTCAATGACAGATTTGCATACGGTGTACCAACTAGAAAGGTATAAATG
GCTAGAGGTGGTAAAGAAGGAAACAATGCTTTTGTTGCAGATATTAACTCATTTGTTGAT
ACCTAAAGCTGGAATGAGAATGAAAGATTAATCTTTTCTCTTCTTGAGAATGAAACAGAA
GTTTAATTTTTGGAATTCTTAAGAGGTCTTAAAGACGAAAATCTCACTACCTCTTTACTT
GAAAAAACATATGTTGCTGTAAGAGCTGGTAATAGAAAGACTGCATCCTATTTGATGAAA
TAAGCTAATAAATTCGGTGGATATGGATTCAACAATCTTCATGAATAGGTTTTATCCTTA
GATGATGTATCCAAATTAGATGAATTCAAAAAAGTAAGTATAACCAAGAAAAGCACAGGT
GTTTATAGCAAGAATAGTTATGGTTTTGGAGGTGCATAGGGTATTATTACTCCTATTCAT
TGTGCAGCCATCAATCCTAATCCAGAATTCATCAAAAAGTTGTTAGAAATATCACCTGAA
TTCACAATTCCCGATGATTTAATGAGAAAGCCAGTTCACTATGCAGCAACTTGCGAAGGT
CCTGGTCCTCTTAGTTATCTTTTAAAATAGGGTGTTGATGCAAGAGAAGGTGATAAGAAA
AAAATTACACCTTTAATGCTTGCTTGTTAATTTGGTAGAGCCAAGAATGTAGAAATTTTG
TTAGATGCAAATGGCAAATCAAACCCTGATACTCGTACTAGAGAAGGTTACAGAGCTATT
CATTATGCAGCCCACTATGGACATCTTGACTGTATTAAATTGATGATTGAAAAAGGTGGT
GTTGAAGTTGATTCTCCTGGTCCCAAAAGAATGACACCTCTCCATATTGCTACTTCAAGA
GGTCATTTTGAGATCGTGGAATATCTTCTTTCAAAAGGAGCTAAAGTTATTGTAAAAGAT
AAGTTTAAACGTAGTGCAGTCATTCATGCTACTGCTAATGGCTATCTTAAGATTTTAAGT
CTTATTTTAAAGAATGGTGGACCATTCAATGACCCAGATTCCTCAGGTAACTATCCTGTA
CATTATGCAGCTGCATATGGATTTTAAGCTTGTCTTGATTTACTCAAATAAGCTGGAGCT
GACTTTAATCCTCAAAATTCTTGGAATTTAACTCCTCTCTCAATTGCTATGGCTAAAGGA
CATTTTGGAATGGTTAAGAAGCTCTTAAATTATCCTGAATGCGATGTTAACTGCACTGAT
GTTAAAGGTAGAACTATCATATCAAGAGCTACTGAAAAATTAAATCTAAATAATCTCTCT
CAATTCGAATTCATTCTCAAAGAGAAGAAAGCAAATCCTAATATGGCTGATTTACAAGGT
CAATCGCCTCTTCATTATCTTTGTAACTTATCAAAAGATGATTATGTTAGCAAAAGATAG
AATGAAGAAAATGCTCATCATGTTACTAAAAAATATGAAGAAGAATATGAAAAGATTGTC
TAAAAAGCTACTTAAATTTTACTTGATTGTGGAGCTGATATTAACAAATTAAACACTATG
GAAGAATCTCCATTAACTATTGCTATCAAATAATAGAATTTCTTTATTTTAAATATTTTA
TTAAAGAAAGGAGGCCTCGATTTCTCTCATGTTAACTAAATTGATCAAAATATTCTACAC
ACCTTAAATACTTTAATTTTAGAAGGACCAAGTGGAATCGATCAATTCTATAATATCTTT
GAAGAAATCAAAAAAGATAAAAACGTAAATCTTAAAGAATACTTGAATAAAGTTGATTAT
CATGGTTTTTCACCTTTGTTAATGTACGTTAAAATATTCAGTGAAAATGCTTCTCATTAT
AGAGAATAAAGAGTTGAGGAATTAAGCCAAGAAATATACTCTAAGAAAGGAGGCTCAGCA
CCTAATAAAAAGAATCCTATCAAAAAGTAAGCCCCTACAAGAGGTCCTAGAGTAGCAAAA
AAAGCAATTAGAAGTGCACCAGCAAAATCATTAATTGGATTTAGCAATGATGGAGCCTTA
GTTTAATTAACAGAAAAGGAATTAGAAAAAGTTTAAAAACAAGCTGATGAAGATTTATTG
CAATTTGAGCAAAAATTCTAAAAATTAATTACTTTCTTGGTCGAAAAGGGTTCAGATGTA
GAAGCTAAAGTTTAAAAAATTAAAAAATATAGATCAAACATGGATGTAGAAGATAAATCA
GATAATGAAGAATAATAAGAATAAGACGAAGATGATGATGAAAATGAAGGAAATAAAACC
TTAAAAGATGAGATGGGTAATCCAATTTAAAATAAAAAAGTTAAGTACATTCCAGAATAT
AATTCTTGTGGAGAAATGAATATATTTGGATTAGCTCTTAGCCACCTATCTTTACCTTAC
TTAAAATTCATTCATGAATAGTATCCTTAATTAGTTAACAACGTTGATTATCTCAAGAGA
AATCATCTCCATAAATTTATTTTGAAAAATGATGATGAACCAGCTACAAACGTTTCTCAT
AAAGTTTTAGAGTGGCTCACTACTTTAAAGATAGATATTAATTAAAAAGATATTATTGAA
TCAACTCCTTTAATCTCAGCTATTTCTTAGAAAAAGTACAAGTTTGCAAAGACTCTTATT
AATCACAAGGCATAAGTCGATGTTAAGGATATATTTGGAAAGACACCACTTATTATGGCA
ATTAACAATATTCAGAGCAACAATCTTGAATTTGTTGAATACTTACTTTCTAATGGTGCT
TCAGCAAACTTTGCTGATAACTATGGCAGAACACCCTTGCATCATGCCATCAATAAGGCT
GATAAAGGTGCCAATGCTTCTTTTGATCTCGAAAATCTCTTGATTAAGAATAAAGCAGAT
ATTAATGCTGCTGACTCTCTTGGTAGAACTCCTCTTCACTATTGTTTTGTTAGCCTCTAA
GATTAGTAATATAGTACATTACAGTATGATCCTTTTGAAACTGTTAGCAGTCTTTGTAAC
CAATCCAATATTAAGATTGACGTTAAAGATAATTTAGGAAAGACTCCTTTGCATTATGCT
GCTTAAAAAAATTCTACTATATCTGTAATCTATATGATCGAAAAGAAAGCTAATATTGAT
ATTGAAGATGCCAATGGTAATACTCCATTAGCTGTCGCTTTCCGTTTCAAAAGAAGTGAA
ATTACTACTACCCTTATTCAAAATGGTGCTAATACTTCAAAGTTCATAACTATTAACAAG
AATTTAAAACCAAACGGGGAAGAAGAGGAAGAATACAAAGAACCTGCTAAAGATCATTGG
GGTAATCCAATCAAAACTAGAAGAAGATAAAACTATTCTAGCTATGGAAGCAGATACTTA
TTCTAATATCAAAATCAATATGATGGATTTGGAGGTGACCAAAATTCAAATAATAGTATC
ATCAAAAAATTACTTAGTGAATACCATATTGAAGAAGACAGTTATATCGAATTAGTTAAA
AGAAGCATCACAAAAGAATAGTTTAAGGAAAAAGGCTTAGATAATCTCGTCTTTTAAGAA
TTTAGAGTAAGAGGTGATTTACCATTAGGTAAGCATTCATTTTTCAAGGCATCTATCACT
TTCTAATGGTAGGGTATTGCCTATTTGCTTTTAATCAAGGGCAATTACAATCTTTTTAAT
GCTTTAGAGGATGCCATTAAAATTGATCTTTATTAACTTTCAATCACTCTTCTTTTTAAG
TATCCAGAAGATGAAACGATTACTTAATGTAATAGCGAAGGACAAAACCTGATACACATT
TTGTGTCAAAGATCTCCTAGAGATGTTAATCTTTAAGTGAAGCTTTTTGAAACTCTTTTG
AATAGAGGTGTTGATGCTAAAAAATTAGATAATAAGAAGAATCTTTGCTTGCATTTTGCT
TTCCTTCATCATTAACTTACTCCCAAACTACTAGAATTAGGATTAGATTGCAATGCCTAC
AATGATGACTAATAAACACCATTTGCCTTAGCTATTTAAGAAGATGCAAAATAAGCATTG
AAAATATATACAGCTAACTACAAACCTGACTATTCTAAAAAATTCAAAGCTAAATTAGAA
GGCCATTAAGACTATTTATAATTTACACCTTTGCTTATTTAATTTGCAAATAAAAATAAA
GATTTAGTTTTATTGAATCATTTATTGGCAAATGGATCAAATATTAACGAAGTTGATAAT
TTAGGTAGAAATGCCCTCTATTATGCTATATATCACAACTCTCACAAATTAGTTAAATTT
GTTCTTTAAACAAAGAAATTCGATGTTAAGCATGTAGATAATCAAGGCAAAAATGCTGTT
CACTACGTTGTTAATCCAGTTGAATTTGGCTCTTATGAAAATACAGAAATATTAGAGCTA
CTTCACAATGCAAAAATAGATTTCAATGTAAAGGATAAGGATGGAAATACTGCAATGTTT
TATGCTTTGCAATAAGATTCCAAAAAAATGGCAGAATCCTTGAAAAAATACGGTGTTGAA
GCTCTTAAAGAAAAGAAATTGCCTTAAAGAGCTGCTACTTCAATAGTAACTGATGCTTTA
TTCCCTGATGAAGAAATTGATTATGAAGAAGACAGTAAGAAGTTTAGCGAAGAAACTACT
TATGATCAATATAAGGAATTCTTTGAGCAAAAGAATGCTGGTGATAAAGTTTATCTCGAT
AAGTATGTAGCTGGAAACTACAAAAAGAAAGATAATTATGTAGTACTTGATGATAATAAT
GAACCATACAACTTGCTCATGACTAAAGTTGATCTCGGAGGAGGATTTGCTAAGTATGTA
TTCTACATCATGTAAGTTATTCATGATAAAAATTCAGACGTTTATATTCTTTACACTCGT
TGGGGTCATATGGGTGGTATGGGTCAAATGCAACACACTCCTTTTGCTACCAAAGAAGCT
GCCGTTAAGGAATTCAGTAAAATTTTCTACTAAAAGTCTGGAAACGATTGGACTAACAGA
CACAACTTCAAAAAATAAGATAAGAAATATTAACTTGTTATCTTCGAGAAAGGAAATGAT
AAAAAATCTTTCTCTTTAAAGCCTTATGACTTTGAACGTCTAAATTGTTCAGCTTCATAG
CTCGAAAAGCCTATTTAAGAGTTTATTAAGAATATTTCTAATGCAGAAATTTTCAAATAA
GCATATCGCCAATTTGCCCTTTCTGACTAATATCTTCCCATAACTAAGCTATCAAAAGCA
GCCTTAATTGAAGCTTAGGGCATTCTTGCAGATATTAGAGAAGAAGTCATAGAAATCTAA
AAATTAAGAAGTAAATTAACTTAAGGAAATAACATGCAACTTCTTTTAGAAAGAGAAGAA
AGCGTACTTCGTTATAGCAATAGATATTATGAACTTGTTCCAAGAGCTGTTTCTAAATGG
GAGCCTGCTCAACCCTTAAACCATGAACATAATATTTCTTAAGAATAGCGTCTTGTTGAA
AATTTACTTGATTTTGAAGCTGCTATTAAGATTATCATGGGTTCTTATACTAAGCTTCAA
GTAATGCATCCTTTGGATTACTGTTTCAACTCATTAAGCATCCGTATGAAATAAATTTAA
AATGAACATCCTGAATATAAAATGATTTAGTAATACGTTTCCAGAACAAATCATAAAGCT
ACTGATCCTAATTCTTAGTTTATTAGAAATGTTTTCGCTGTTGAGAGAAGAGGTGAGGCT
GAAAGAATTAAATAATTCTCTGATCATACTAAAAAGCTTTTATGGCACGGCAGTGGTGTT
TAAAATCTCTTAAGTATTCTTAATTTTGGTTTAAGAATCAATGGTATTCATGCCTAAAAA
TCTGGAAGCTCTCTTGGTGACGGAATCTACTTTGCTGATTTATTCTCCAAGGCAAGTGCT
TATGCTAACAATGCTGATGTTGGTGTCGAATCAAGATTCTTACTTCTTTGTGAAGTTGCA
GTTGGAAAGGAATAACAAATTAAAACTAATGAAAATTTTACTAAGTTTGCTAACTCAAAT
TATTAACTTATGAAAGGCTTTAACAGTGTTAAACTTGTAGGTAAGTCTTGTCCTGATGAA
AAGAAAAATCTTGTTTTACCAAACGGTACTATTGTTCCAATCGGACCAATAATTGATTTC
AATGAAAACTTGAAGTAGAAACTTCAAATAGAGAAATCTACCAAAAAGAGTGCAAAAAAA
TCTACTAAAAAACCTGCTTAGAAAATACCTGCTAGACCTATCAAGAAGGTAGTCAAAGCT
ACTAAATATTCATCAGATGAAGAAAACTCTCAAGATGAAGAAAGCTAAATTTAGGTTGAA
GAAGACGAACTTGATATTCCTGAAGATGAAATTTAATCTGATGGTGATGAGGAAATAGAA
GAGGAAGAAGATAACTTTGATGAAGAATAAGATGAACAAAATCTTTTATAAAATAATTTC
TTATATGACGTACAACACTAAGGTGCTAAGACTCCATTCAATTAGCTCTTTACTCAATAT
TAAAATAGTGAATACGTAGTTTACAACTCAGCTCAAGTTAGAATAAGATATTTAATTGAA
ATAAGAGATTGA


>TTHERM_00502600(protein)
MADKGIFIYAVRDEDSMQGFILVASEVDIDVENSKAEKVGVYHIHSVKNKPYNYTVNKKL
TNVRLDEFMSVVDEDLYEFNEKNRTLVFDKKGYDNLIGQLMDDLEEENDDDSSEEEEKKK
KKPAPKAASARKTRSSKGSDKVKGSDSESYEAADEEDEEEKKRSRGRPKKNKSTEEITED
KDENSQEDQPKPKGKRGRPPSKDKAASVAVPKKQDKQDDKDGEENGEDQNGHEENGDEDK
EEGEQKRVPGKRGRKPGKKTAETPAKKEAQQNIIHNRKPQVFLIQRPGKRGRKPAKKGSE
SEDNEDADDEQEEVSKKGAKKKVEKYKKGSHNPNIPDVVKTDETFEGDSQDINDVCCSFC
TNRELLRAVYTGNSNLLKKLVQSKAKVSTLFAKRGPDADETTLEIILKNKDKKCLDVLIN
ALNKKSEISLASNPECSLEEVYTGFNDRFAYGVPTRKVQMARGGKEGNNAFVADINSFVD
TQSWNENERLIFSLLENETEVQFLEFLRGLKDENLTTSLLEKTYVAVRAGNRKTASYLMK
QANKFGGYGFNNLHEQVLSLDDVSKLDEFKKVSITKKSTGVYSKNSYGFGGAQGIITPIH
CAAINPNPEFIKKLLEISPEFTIPDDLMRKPVHYAATCEGPGPLSYLLKQGVDAREGDKK
KITPLMLACQFGRAKNVEILLDANGKSNPDTRTREGYRAIHYAAHYGHLDCIKLMIEKGG
VEVDSPGPKRMTPLHIATSRGHFEIVEYLLSKGAKVIVKDKFKRSAVIHATANGYLKILS
LILKNGGPFNDPDSSGNYPVHYAAAYGFQACLDLLKQAGADFNPQNSWNLTPLSIAMAKG
HFGMVKKLLNYPECDVNCTDVKGRTIISRATEKLNLNNLSQFEFILKEKKANPNMADLQG
QSPLHYLCNLSKDDYVSKRQNEENAHHVTKKYEEEYEKIVQKATQILLDCGADINKLNTM
EESPLTIAIKQQNFFILNILLKKGGLDFSHVNQIDQNILHTLNTLILEGPSGIDQFYNIF
EEIKKDKNVNLKEYLNKVDYHGFSPLLMYVKIFSENASHYREQRVEELSQEIYSKKGGSA
PNKKNPIKKQAPTRGPRVAKKAIRSAPAKSLIGFSNDGALVQLTEKELEKVQKQADEDLL
QFEQKFQKLITFLVEKGSDVEAKVQKIKKYRSNMDVEDKSDNEEQQEQDEDDDENEGNKT
LKDEMGNPIQNKKVKYIPEYNSCGEMNIFGLALSHLSLPYLKFIHEQYPQLVNNVDYLKR
NHLHKFILKNDDEPATNVSHKVLEWLTTLKIDINQKDIIESTPLISAISQKKYKFAKTLI
NHKAQVDVKDIFGKTPLIMAINNIQSNNLEFVEYLLSNGASANFADNYGRTPLHHAINKA
DKGANASFDLENLLIKNKADINAADSLGRTPLHYCFVSLQDQQYSTLQYDPFETVSSLCN
QSNIKIDVKDNLGKTPLHYAAQKNSTISVIYMIEKKANIDIEDANGNTPLAVAFRFKRSE
ITTTLIQNGANTSKFITINKNLKPNGEEEEEYKEPAKDHWGNPIKTRRRQNYSSYGSRYL
FQYQNQYDGFGGDQNSNNSIIKKLLSEYHIEEDSYIELVKRSITKEQFKEKGLDNLVFQE
FRVRGDLPLGKHSFFKASITFQWQGIAYLLLIKGNYNLFNALEDAIKIDLYQLSITLLFK
YPEDETITQCNSEGQNLIHILCQRSPRDVNLQVKLFETLLNRGVDAKKLDNKKNLCLHFA
FLHHQLTPKLLELGLDCNAYNDDQQTPFALAIQEDAKQALKIYTANYKPDYSKKFKAKLE
GHQDYLQFTPLLIQFANKNKDLVLLNHLLANGSNINEVDNLGRNALYYAIYHNSHKLVKF
VLQTKKFDVKHVDNQGKNAVHYVVNPVEFGSYENTEILELLHNAKIDFNVKDKDGNTAMF
YALQQDSKKMAESLKKYGVEALKEKKLPQRAATSIVTDALFPDEEIDYEEDSKKFSEETT
YDQYKEFFEQKNAGDKVYLDKYVAGNYKKKDNYVVLDDNNEPYNLLMTKVDLGGGFAKYV
FYIMQVIHDKNSDVYILYTRWGHMGGMGQMQHTPFATKEAAVKEFSKIFYQKSGNDWTNR
HNFKKQDKKYQLVIFEKGNDKKSFSLKPYDFERLNCSASQLEKPIQEFIKNISNAEIFKQ
AYRQFALSDQYLPITKLSKAALIEAQGILADIREEVIEIQKLRSKLTQGNNMQLLLEREE
SVLRYSNRYYELVPRAVSKWEPAQPLNHEHNISQEQRLVENLLDFEAAIKIIMGSYTKLQ
VMHPLDYCFNSLSIRMKQIQNEHPEYKMIQQYVSRTNHKATDPNSQFIRNVFAVERRGEA
ERIKQFSDHTKKLLWHGSGVQNLLSILNFGLRINGIHAQKSGSSLGDGIYFADLFSKASA
YANNADVGVESRFLLLCEVAVGKEQQIKTNENFTKFANSNYQLMKGFNSVKLVGKSCPDE
KKNLVLPNGTIVPIGPIIDFNENLKQKLQIEKSTKKSAKKSTKKPAQKIPARPIKKVVKA
TKYSSDEENSQDEESQIQVEEDELDIPEDEIQSDGDEEIEEEEDNFDEEQDEQNLLQNNF
LYDVQHQGAKTPFNQLFTQYQNSEYVVYNSAQVRIRYLIEIRD


>TTHERM_00502600(gene)
ATGGCTGATAAAGGAATTTTTATTTACGCAGTCAGAGATGAAGACAGCATGCAAGGCTTC
ATCTTGGTTGCTAGTGAGGTAGATATTGATGTGGAAAACTCTAAGGCAGAGAAGGTTGGA
GTTTACCATATTCATTCTGTAAAAAATAAACCATACAATTATACAGTCAACAAAAAACTC
ACTAATGTAAGACTTGATGAGTTTATGAGCGTAGTAGATGAGGATTTATATGAGTTTAAT
GAAAAGAATAGAACTCTAGTATTCGATAAGAAAGGTTATGACAACTTAATTGGTTAACTT
ATGGATGATTTAGAAGAAGAAAATGATGATGACTCATCAGAAGAAGAAGAAAAAAAAAAG
AAGAAACCTGCTCCTAAGGCAGCTTCTGCCAGGAAAACTCGTAGTTCTAAGGGATCTGAT
AAGGTTAAGGGATCTGACAGTGAAAGCTATGAGGTAATTAACAAAAAATTAAAATTTCGT
TTTTAATTTCTTAATTTTGTAAAAAGTTTACTATTTTTTAAAACTTAGAATAAAGACATC
AATCAATCAAACGTTTTTATTATTTATTTTGTTCGTTGTCTTATGATTGGATTTCTTAAT
TTATTATAAATTATATGTTCTTATTAGATATTTGCAATCCAATATCAGAAAATAAAATTT
TACAAAAATTTTGTTCATAAACATTACAATTTAATATCTATAAATTTTAAATATCTTTTT
GCTTTTTATTGAGTTGATATAATTTAAAATAAACTAAATAAATAACGTATTATTTTAAAG
GCAGCTGACGAAGAAGATGAAGAAGAAAAAAAGAGATCAAGAGGAAGACCTAAAAAAAAT
AAATCCACTGAAGAAATTACAGAAGATAAAGACGAAAACTCTTAAGAGGATTAACCTAAG
CCTAAAGGAAAAAGAGGAAGACCTCCTTCTAAGGATAAAGCTGCATCAGTCGCTGTTCCA
AAAAAATAGGATAAGTAGGATGATAAAGATGGAGAAGAAAATGGTGAAGATTAAAATGGT
CATGAAGAAAATGGAGATGAAGATAAGGAAGAAGGAGAGTAAAAACGTGTTCCTGGTAAA
CGTGGCAGAAAGCCAGGTAAAAAAACAGCAGAAACACCTGCAAAAAAAGAAGCGTAATAA
AATATTATACATAATAGAAAGCCATAAGTATTTTTAATTTAAAGACCTGGAAAAAGAGGA
AGAAAGCCAGCAAAGAAGGGCTCAGAATCAGAAGATAATGAAGATGCTGATGATGAATAA
GAAGAAGTCTCAAAAAAGGGAGCAAAAAAGAAAGTAGAAAAATATAAGAAAGGTTCACAC
AATCCTAATATACCTGATGTAGTCAAAACTGACGAAACTTTCGAAGGTGATTCTTAAGAT
ATTAATGACGTTTGTTGCTCATTCTGCACAAACAGAGAAGTACTAATTAATTTGAGAAAA
ATTTAAATTTTGAAATTTTAATTAATTAACTAATTAGTTGTTAAGAGCTGTTTACACAGG
TAATAGTAATCTTTTGAAAAAATTAGTTTAGTCAAAAGCAAAGGTAAAGAAATCATTTTA
TTAATGCATAATTTTTATCAAAATCAATACTATTATTAAATAGGTCTCTACTTTGTTTGC
CAAGAGAGGTCCTGATGCTGATGAAACCACACTTGAAATCATTCTTAAAAACAAGGATAA
AAAGTGCCTTGATGTTTTGATTAATGCTCTTAACAAGAAATCAGAAATTTCTTTAGCTTC
TAATCCTGAATGCTCCTTAGAAGAAGTCTATACTGGTTTCAATGACAGATTTGCATACGG
TGTACCAACTAGAAAGGTATAAATGGCTAGAGGTGGTAAAGAAGGAAACAATGCTTTTGT
TGCAGATATTAACTCATTTGTTGATACCTAAAGCTGGAATGAGAATGAAAGATTAATCTT
TTCTCTTCTTGAGAATGAAACAGAAGTTTAATTTTTGGAATTCTTAAGAGGTCTTAAAGA
CGAAAATCTCACTACCTCTTTACTTGAAAAAACATATGTTGCTGTAAGAGCTGGTAATAG
AAAGACTGCATCCTATTTGATGAAATAAGCTAATAAATTCGGTGGATATGGATTCAACAA
TCTTCATGAATAGGTTTTATCCTTAGATGATGTATCCAAATTAGATGAATTCAAAAAAGG
TAAATTCATTTTTAAGATAAACCAAAAATGCATGAATTTTTTAAAGTAAGTATAACCAAG
AAAAGCACAGGTGTTTATAGCAAGAATAGTTATGGTTTTGGAGGTGCATAGGGTATTATT
ACTCCTATTCATTGTGCAGCCATCAATCCTAATCCAGAATTCATCAAAAAGTTGTTAGAA
ATATCACCTGAATTCACAATTCCCGATGATTTAATGAGAAAGCCAGTTCACTATGCAGCA
ACTTGCGAAGGTATTTATTTAACTCATACTTGCCTTTAAAAATATTTATAATAAATAAAT
AAACATAATTTAAAAATAGGTCCTGGTCCTCTTAGTTATCTTTTAAAATAGGGTGTTGAT
GCAAGAGAAGGTGATAAGAAAAAAATTACACCTTTAATGCTTGCTTGTTAATTTGGTAGA
GCCAAGAATGTAGAAATTTTGTTAGATGCAAATGGCAAATCAAACCCTGATACTCGTACT
AGAGAAGGTTACAGAGCTATTCATTATGCAGCCCACTATGGACATCTTGACTGTATTAAA
TTGATGATTGAAAAAGGTGGTGTTGAAGTTGATTCTCCTGGTCCCAAAAGAATGACACCT
CTCCATATTGCTACTTCAAGAGGTCATTTTGAGATCGTGGAATATCTTCTTTCAAAAGGA
GCTAAAGTTATTGTAAAAGATAAGTTTAAACGTAGTGCAGTCATTCATGCTACTGCTAAT
GGCTATCTTAAGATTTTAAGTCTTATTTTAAAGAATGGTGGACCATTCAATGACCCAGAT
TCCTCAGGTAACTATCCTGTACATTATGCAGCTGCATATGGATTTTAAGCTTGTCTTGAT
TTACTCAAATAAGCTGGAGCTGACTTTAATCCTCAAAATTCTTGGAATTTAACTCCTCTC
TCAATTGCTATGGCTAAAGGTAATAAATAGATTTAAATAATTTTTTTAAGTAATTTAAAA
ATATAAATAATTTAGGACATTTTGGAATGGTTAAGAAGCTCTTAAATTATCCTGAATGCG
ATGTTAACTGCACTGATGTTAAAGGTAGAACTATCATATCAAGAGCTACTGAAAAATTAA
ATCTAAATAATCTCTCTCAATTCGAATTCATTCTCAAAGAGAAGAAAGCAAATCCTAATA
TGGCTGATTTACAAGGTCAATCGCCTCTTCATTATCTTTGTAACTTATCAAAAGATGATT
ATGTTAGCAAAAGATAGAATGAAGAAAATGCTCATCATGTTACTAAAAAATATGAAGAAG
AATATGAAAAGATTGTCTAAAAAGCTACTTAAATTTTACTTGATTGTGGAGCTGATATTA
ACAAATTAAACACTATGGAAGAATCTCCATTAACTATTGCTATCAAATAATAGAATTTCT
TTATTTTAAATATTTTATTAAAGAAAGGAGGCCTCGATTTCTCTCATGTTAACTAAATTG
ATCAAAATATTCTACACACCTTAAATACTTTAATTTTAGAAGGACCAAGTGGAATCGATC
AATTCTATAATATCTTTGAAGAAATCAAAAAAGATAAAAACGTAAATCTTAAAGAATACT
TGAATAAAGTTGATTATCATGGTTTTTCACCTTTGTTAATGTACGTTAAAATATTCAGTG
AAAGTAAATTTTTAAAGCTTATTATATTAAAATAATTTTTGTATTTATTTATTTCTTTAT
TTAAATTTTATAAAAAGATGCTTCTCATTATAGAGAATAAAGAGTTGAGGAATTAAGCCA
AGAAATATACTCTAAGAAAGGAGGCTCAGCACCTAATAAAAAGAATCCTATCAAAAAGTA
AGCCCCTACAAGAGGTCCTAGAGTAGCAAAAAAAGCAATTAGAAGTGCACCAGCAAAATC
ATTAATTGGATTTAGCAATGATGGAGCCTTAGTTTAATTAACAGAAAAGGAATTAGAAAA
AGTTTAAAAACAAGCTGATGAAGATTTATTGCAATTTGAGCAAAAATTCTAAAAATTAAT
TACTTTCTTGGTCGAAAAGGGTTCAGATGTAGAAGCTAAAGTTTAAAAAATTAAAAAATA
TAGATCAAACATGGATGTAGAAGATAAATCAGATAATGAAGAATAATAAGAATAAGACGA
AGATGATGATGAAAATGAAGGAAATAAAACCTTAAAAGATGAGATGGGTAATCCAATTTA
AAATAAAAAAGTTAAGTACATTCCAGAATATAATTCTTGTGGAGAAATGAATATATTTGG
ATTAGCTCTTAGCCACCTATCTTTACCTTACTTAAAATTCATTCATGAATAGTATCCTTA
ATTAGTTAACAACGTTGATTATCTCAAGAGAAATCATCTCCATAAATTTATTTTGAAAAA
TGATGATGAACCAGCTACAGTAAACAAGATATTTGTTTAAATTTTCTTAATTTAATTTAA
AAATTTTTATAATTAGAACGTTTCTCATAAAGTTTTAGAGTGGCTCACTACTTTAAAGAT
AGATATTAATTAAAAAGATATTATTGAATCAACTCCTTTAATCTCAGCTATTTCTTAGAA
AAAGTACAAGTTTGCAAAGACTCTTATTAATCACAAGGCATAAGTCGATGTTAAGGATAT
AGTAAATTAATTAACAAAATATTTTTATCGAAGCAACATTTTTTTTTTTGAAAACAGTTT
GGAAAGACACCACTTATTATGGCAATTAACAATATTCAGAGCAACAATCTTGAATTTGTT
GAATACTTACTTTCTAATGGTGCTTCAGCAAACTTTGCTGATAACTATGGCAGGTAAAAT
GAATATACTTTAAATACTTTTTTTAAACTAATTTTAATTAAATAGAACACCCTTGCATCA
TGCCATCAATAAGGCTGATAAAGGTGCCAATGCTTCTTTTGATCTCGAAAATCTCTTGAT
TAAGAATAAAGCAGATATTAATGCTGCTGACTCTCTTGGTAGAACTCCTCTTCACTATTG
TTTTGTTAGCCTCTAAGATTAGTAATATAGTACATTACAGTATGATCCTTTTGAAACTGT
TAGCAGTCTTTGTAACCAATCCAATATTAAGATTGACGTTAAAGATAATTTAGGAAAGAC
TCCTTTGCATTATGCTGCTTAAAAAAATTCTACTATATCTGTAATCTATATGATCGAAAA
GAAAGCTAATATTGATATTGAAGATGCCAATGGTAATACTCCATTAGCTGTCGCTTTCCG
TTTCAAAAGAAGTGAAATTACTACTACCCTTATTCAAAATGGTGCTAATACTTCAAAGTT
CATAACTATTAACAAGAATTTAAAACCAAACGGGGAAGAAGAGGAAGAATACAAAGAACC
TGCTAAAGATCATTGGGGTAATCCAATCAAAACTAGAAGAAGATAAAACTATTCTAGCTA
TGGAAGCAGATACTTATTCTAATATCAAAATCAATATGATGGATTTGGAGGTGACCAAAA
TTCAAATAATAGTATCATCAAAAAATTACTTAGTGAATACCATATTGAAGAAGACAGTTA
TATCGAATTAGTTAAAAGAAGCATCACAAAAGAATAGTTTAAGGAAAAAGGCTTAGATAA
TCTCGTCTTTTAAGAATTTAGAGTAAGAGGTGATTTACCATTAGGTAAGCATTCATTTTT
CAAGGCATCTATCACTTTCTAATGGTAGGGTATTGCCTATTTGCTTTTAATCAAGGGCAA
TTACAATCTTTTTAATGCTTTAGAGGATGCCATTAAAATTGATCTTTATTAACTTTCAAT
CACTCTTCTTTTTAAGTATCCAGAAGATGAAACGATTACTTAATGTAATAGCGAAGGACA
AAACCTGATACACATTTTGTGTCAAAGATCTCCTAGAGATGTTAATCTTTAAGTGAAGCT
TTTTGAAACTCTTTTGAATAGAGGTGTTGATGCTAAAAAATTAGATAATAAGAAGAATCT
TTGCTTGCATTTTGCTTTCCTTCATCATTAACTTACTCCCAAACTACTAGAATTAGGATT
AGATTGCAATGCCTACAATGATGACTAATAAACACCATTTGCCTTAGCTATTTAAGAAGA
TGCAAAATAAGCATTGAAAATATATACAGCTAACTACAAACCTGACTATTCTAAAAAATT
CAAAGCTAAATTAGAAGGCCATTAAGACTATTTATAATTTACACCTTTGCTTATTTAATT
TGCAAATAAAAATAAAGATTTAGTTTTATTGAATCATTTATTGGCAAATGGATCAAATAT
TAACGAAGTTGATAATTTAGGTAGAAATGCCCTCTATTATGCTATATATCACAACTCTCA
CAAATTAGTTAAATTTGTTCTTTAAACAAAGAAATTCGATGTTAAGCATGTAGATAATCA
AGGCAAAAATGCTGTTCACTACGTTGTTAATCCAGTTGAATTTGGCTCTTATGAAAATAC
AGAAATATTAGAGCTACTTCACAATGCAAAAATAGATTTCAATGTAAAGGATAAGGATGG
GTAAATATTTTTTGTTGTTGTAAATATAAATTTAATAATTCATTTTAAATTAGAAATACT
GCAATGTTTTATGCTTTGCAATAAGATTCCAAAAAAATGGCAGAATCCTTGAAAAAATAC
GGTGTTGAAGCTCTTAAAGAAAAGAAATTGCCTTAAAGAGCTGCTACTTCAATAGTAACT
GATGCTTTATTCCCTGATGAAGAAATTGATTATGAAGAAGACAGTAAGAAGTTTAGCGAA
GAAACTACTTATGATCAATATAAGGTTAATACAAAAATTAAGTCAAACAAAATTTAATAT
TTATGATTTTATTAAAAGGAATTCTTTGAGCAAAAGAATGCTGGTGATAAAGTTTATCTC
GATAAGTATGTAGCTGGAAACTACAAAAAGAAAGATAATTATGTAGTACTTGATGATAAT
AATGAACCATACAACTTGCTCATGACTAAAGTTGATCTCGGAGGAGGATTTGCTAAGTAT
GTATTCTACATCATGTAAGTTATTCATGATAAAAATTCAGACGTTTATATTCTTTACACT
CGTTGGGGTCATATGGGTGGTATGGGTCAAATGCAACACACTCCTTTTGCTACCAAAGAA
GCTGCCGTTAAGGAATTCAGTAAAATTTTCTACTAAAAGGTAACTTAAATTCAAACTTTA
TAATTGTTGAATTAAATTTATTTTATGAATAATTTTTAAATTAGTCTGGAAACGATTGGA
CTAACAGACACAACTTCAAAAAATAAGATAAGAAATATTAACTTGTTATCTTCGAGAAAG
GAAATGATAAAAAATCTTTCTCTTTAAAGCCTTATGACTTTGAACGTCTAAATTGTTCAG
CTTCATAGCTCGAAAAGCCTATTTAAGAGTTTATTAAGAATATTTCTAATGCAGAAATTT
TCAAATAAGCATATCGCCAATTTGCCCTTTCTGACTAATATCTTCCCATAACTAAGCTAT
CAAAAGCAGCCTTAATTGAAGCTTAGGGCATTCTTGCAGATATTAGAGAAGAAGTCATAG
AAATCTAAAAATTAAGAAGTAAATTAACTTAAGGAAATAACATGCAACTTCTTTTAGAAA
GAGAAGAAAGCGTACTTCGTTATAGCAATAGATATTATGAACTTGTTCCAAGAGCTGTTT
CTAAATGGTAAGTTTATTAAAGTTAAAAAATAGTTTTAATTTGTTAAAAATAATCAATAA
ATAAATAGGGAGCCTGCTCAACCCTTAAACCATGAACATAATATTTCTTAAGAATAGCGT
CTTGTTGAAAATTTACTTGATTTTGAAGCTGCTATTAAGATTATCATGGGTTCTTATACT
AAGCTTCAAGTAATGCATCCTTTGGATTACTGTTTCAACTCATTAAGCATCCGTATGAAA
TAAATTTAAAATGAACATCCTGAATATAAAATGATTTAGTAATACGTTTCCAGAACAAAT
CATAAAGCTACTGATCCTAATTCTTAGTTTATTAGAAATGTTTTCGCTGTTGAGAGAAGA
GGTAATTTTATAAAAAATATTAATATCATTAAATATTTTATTTATAATTTTAAAAAGGTG
AGGCTGAAAGAATTAAATAATTCTCTGATCATACTAAAAAGCTTTTATGGCACGGCAGTG
GTGTTTAAAATCTCTTAAGTATTCTTAATTTTGGTTTAAGAATCAATGGTATTCATGCCT
AAAAATCTGGAAGCTCTCTTGGTGACGGAATCTACTTTGCTGATTTATTCTCCAAGGCAA
GTGCTTATGCTAACAATGCTGATGTTGGTGTCGAATCAAGGTATATAACAAATAAATTTA
CATGTATAAAGTTAATATTTATTTTTAATTAAATTGTAGATTCTTACTTCTTTGTGAAGT
TGCAGTTGGAAAGGAATAACAAATTAAAACTAATGAAAATTTTACTAAGTTTGCTAACTC
AAATTATTAACTTATGAAAGGCTTTAACAGTGTTAAACTTGTAGGTAAGTCTTGTCCTGA
TGAAAAGAAAAATCTTGTTTTACCAAACGGTACTATTGTTCCAATCGGACCAATAATTGA
TTTCAATGAAAACTTGAAGTAGAAACTTCAAATAGAGAAATCTACCAAAAAGAGTGCAAA
AAAATCTACTAAAAAACCTGCTTAGAAAATACCTGCTAGACCTATCAAGAAGGTAGTCAA
AGCTACTAAATATTCATCAGATGAAGAAAACTCTCAAGATGAAGAAAGCTAAATTTAGGT
TGAAGAAGACGAACTTGATATTCGTAAAATCACAAAAAAAAAAATAAATTTTAATAACTT
TTTTTTTTTTAAATTTAAGCTGAAGATGAAATTTAATCTGATGGTGATGAGGAAATAGAA
GAGGAAGAAGATAACTTTGATGAAGAATAAGATGAACAAAATCTTTTATAAAATAATTTC
TTATATGACGTACAACACTAAGGTGCTAAGACTCCATTCAATTAGCTCTTTACTCAATAT
TAAAATAGTGAATACGTAGTTTACAACTCAGCTCAAGTTAGAATAAGATATTTAATTGAA
ATAAGAGATTGA