Identifiers and Description

Gene Model Identifier

TTHERM_00502600

Standard Name

PARP6 (Poly [ADP-Ribose] Polymerase 6)

Aliases

PreTt08099 | 63.m00277 | 3716.m00129

Description

PARP6 WGR domain protein; WGR domain containing protein; abundant protein associated with RNA polymerase II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF05406 ) WGR domain
  • ( PF02178 ) AT hook motif
  • ( PF00023 ) Ankyrin repeat
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF09151 ) Domain of unknown function (DUF1936)
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( PF02877 ) Poly(ADP-ribose) polymerase, regulatory domain
  • ( PF04086 ) Signal recognition particle, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00502600

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01738 ) Micronucleus: PAR1 gene partially replaced by neo4-KanR2 cassette.
  • ( SD01783 ) Micronucleus: GCP3 gene partially replaced by neo4-KanR2 cassette.

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09552.19.997093137033517e-262WGR domain-containing protein
(2622 aa)
OxytrichaContig20797.0.g563.001476460448119e-154Ankyrin repeats (3 copies)
DictyBaseDDB_G02917889.99679536751975e-103adprt3 on chromosome: 6 positi
on 795337 to 803296
WormBaseWBGene000040536.997942222381785e-66locus:pme-5 Poly(ADP-ribose)
polymerase pme-5 status:Par
tially_confirmed UniProt:Q9T
XQ1 protein_id:CCD69563.1
Stentor CoeruleusSteCoe_332751.1379798735078682e-50
SGDYIL112W0.000000000010004361180063202HOS4 Subunit of the Set3 compl
ex, which is a meiotic-specifi
c repressor of sporulation spe
cific genes that contains deac
etylase activity; potential Cd
c28p substrate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00502600(coding)
ATGGCTGATAAAGGAATTTTTATTTACGCAGTCAGAGATGAAGACAGCATGCAAGGCTTC
ATCTTGGTTGCTAGTGAGGTAGATATTGATGTGGAAAACTCTAAGGCAGAGAAGGTTGGA
GTTTACCATATTCATTCTGTAAAAAATAAACCATACAATTATACAGTCAACAAAAAACTC
ACTAATGTAAGACTTGATGAGTTTATGAGCGTAGTAGATGAGGATTTATATGAGTTTAAT
GAAAAGAATAGAACTCTAGTATTCGATAAGAAAGGTTATGACAACTTAATTGGTTAACTT
ATGGATGATTTAGAAGAAGAAAATGATGATGACTCATCAGAAGAAGAAGAAAAAAAAAAG
AAGAAACCTGCTCCTAAGGCAGCTTCTGCCAGGAAAACTCGTAGTTCTAAGGGATCTGAT
AAGGTTAAGGGATCTGACAGTGAAAGCTATGAGGCAGCTGACGAAGAAGATGAAGAAGAA
AAAAAGAGATCAAGAGGAAGACCTAAAAAAAATAAATCCACTGAAGAAATTACAGAAGAT
AAAGACGAAAACTCTTAAGAGGATTAACCTAAGCCTAAAGGAAAAAGAGGAAGACCTCCT
TCTAAGGATAAAGCTGCATCAGTCGCTGTTCCAAAAAAATAGGATAAGTAGGATGATAAA
GATGGAGAAGAAAATGGTGAAGATTAAAATGGTCATGAAGAAAATGGAGATGAAGATAAG
GAAGAAGGAGAGTAAAAACGTGTTCCTGGTAAACGTGGCAGAAAGCCAGGTAAAAAAACA
GCAGAAACACCTGCAAAAAAAGAAGCGTAATAAAATATTATACATAATAGAAAGCCATAA
GTATTTTTAATTTAAAGACCTGGAAAAAGAGGAAGAAAGCCAGCAAAGAAGGGCTCAGAA
TCAGAAGATAATGAAGATGCTGATGATGAATAAGAAGAAGTCTCAAAAAAGGGAGCAAAA
AAGAAAGTAGAAAAATATAAGAAAGGTTCACACAATCCTAATATACCTGATGTAGTCAAA
ACTGACGAAACTTTCGAAGGTGATTCTTAAGATATTAATGACGTTTGTTGCTCATTCTGC
ACAAACAGAGAATTGTTAAGAGCTGTTTACACAGGTAATAGTAATCTTTTGAAAAAATTA
GTTTAGTCAAAAGCAAAGGTCTCTACTTTGTTTGCCAAGAGAGGTCCTGATGCTGATGAA
ACCACACTTGAAATCATTCTTAAAAACAAGGATAAAAAGTGCCTTGATGTTTTGATTAAT
GCTCTTAACAAGAAATCAGAAATTTCTTTAGCTTCTAATCCTGAATGCTCCTTAGAAGAA
GTCTATACTGGTTTCAATGACAGATTTGCATACGGTGTACCAACTAGAAAGGTATAAATG
GCTAGAGGTGGTAAAGAAGGAAACAATGCTTTTGTTGCAGATATTAACTCATTTGTTGAT
ACCTAAAGCTGGAATGAGAATGAAAGATTAATCTTTTCTCTTCTTGAGAATGAAACAGAA
GTTTAATTTTTGGAATTCTTAAGAGGTCTTAAAGACGAAAATCTCACTACCTCTTTACTT
GAAAAAACATATGTTGCTGTAAGAGCTGGTAATAGAAAGACTGCATCCTATTTGATGAAA
TAAGCTAATAAATTCGGTGGATATGGATTCAACAATCTTCATGAATAGGTTTTATCCTTA
GATGATGTATCCAAATTAGATGAATTCAAAAAAGTAAGTATAACCAAGAAAAGCACAGGT
GTTTATAGCAAGAATAGTTATGGTTTTGGAGGTGCATAGGGTATTATTACTCCTATTCAT
TGTGCAGCCATCAATCCTAATCCAGAATTCATCAAAAAGTTGTTAGAAATATCACCTGAA
TTCACAATTCCCGATGATTTAATGAGAAAGCCAGTTCACTATGCAGCAACTTGCGAAGGT
CCTGGTCCTCTTAGTTATCTTTTAAAATAGGGTGTTGATGCAAGAGAAGGTGATAAGAAA
AAAATTACACCTTTAATGCTTGCTTGTTAATTTGGTAGAGCCAAGAATGTAGAAATTTTG
TTAGATGCAAATGGCAAATCAAACCCTGATACTCGTACTAGAGAAGGTTACAGAGCTATT
CATTATGCAGCCCACTATGGACATCTTGACTGTATTAAATTGATGATTGAAAAAGGTGGT
GTTGAAGTTGATTCTCCTGGTCCCAAAAGAATGACACCTCTCCATATTGCTACTTCAAGA
GGTCATTTTGAGATCGTGGAATATCTTCTTTCAAAAGGAGCTAAAGTTATTGTAAAAGAT
AAGTTTAAACGTAGTGCAGTCATTCATGCTACTGCTAATGGCTATCTTAAGATTTTAAGT
CTTATTTTAAAGAATGGTGGACCATTCAATGACCCAGATTCCTCAGGTAACTATCCTGTA
CATTATGCAGCTGCATATGGATTTTAAGCTTGTCTTGATTTACTCAAATAAGCTGGAGCT
GACTTTAATCCTCAAAATTCTTGGAATTTAACTCCTCTCTCAATTGCTATGGCTAAAGGA
CATTTTGGAATGGTTAAGAAGCTCTTAAATTATCCTGAATGCGATGTTAACTGCACTGAT
GTTAAAGGTAGAACTATCATATCAAGAGCTACTGAAAAATTAAATCTAAATAATCTCTCT
CAATTCGAATTCATTCTCAAAGAGAAGAAAGCAAATCCTAATATGGCTGATTTACAAGGT
CAATCGCCTCTTCATTATCTTTGTAACTTATCAAAAGATGATTATGTTAGCAAAAGATAG
AATGAAGAAAATGCTCATCATGTTACTAAAAAATATGAAGAAGAATATGAAAAGATTGTC
TAAAAAGCTACTTAAATTTTACTTGATTGTGGAGCTGATATTAACAAATTAAACACTATG
GAAGAATCTCCATTAACTATTGCTATCAAATAATAGAATTTCTTTATTTTAAATATTTTA
TTAAAGAAAGGAGGCCTCGATTTCTCTCATGTTAACTAAATTGATCAAAATATTCTACAC
ACCTTAAATACTTTAATTTTAGAAGGACCAAGTGGAATCGATCAATTCTATAATATCTTT
GAAGAAATCAAAAAAGATAAAAACGTAAATCTTAAAGAATACTTGAATAAAGTTGATTAT
CATGGTTTTTCACCTTTGTTAATGTACGTTAAAATATTCAGTGAAAATGCTTCTCATTAT
AGAGAATAAAGAGTTGAGGAATTAAGCCAAGAAATATACTCTAAGAAAGGAGGCTCAGCA
CCTAATAAAAAGAATCCTATCAAAAAGTAAGCCCCTACAAGAGGTCCTAGAGTAGCAAAA
AAAGCAATTAGAAGTGCACCAGCAAAATCATTAATTGGATTTAGCAATGATGGAGCCTTA
GTTTAATTAACAGAAAAGGAATTAGAAAAAGTTTAAAAACAAGCTGATGAAGATTTATTG
CAATTTGAGCAAAAATTCTAAAAATTAATTACTTTCTTGGTCGAAAAGGGTTCAGATGTA
GAAGCTAAAGTTTAAAAAATTAAAAAATATAGATCAAACATGGATGTAGAAGATAAATCA
GATAATGAAGAATAATAAGAATAAGACGAAGATGATGATGAAAATGAAGGAAATAAAACC
TTAAAAGATGAGATGGGTAATCCAATTTAAAATAAAAAAGTTAAGTACATTCCAGAATAT
AATTCTTGTGGAGAAATGAATATATTTGGATTAGCTCTTAGCCACCTATCTTTACCTTAC
TTAAAATTCATTCATGAATAGTATCCTTAATTAGTTAACAACGTTGATTATCTCAAGAGA
AATCATCTCCATAAATTTATTTTGAAAAATGATGATGAACCAGCTACAAACGTTTCTCAT
AAAGTTTTAGAGTGGCTCACTACTTTAAAGATAGATATTAATTAAAAAGATATTATTGAA
TCAACTCCTTTAATCTCAGCTATTTCTTAGAAAAAGTACAAGTTTGCAAAGACTCTTATT
AATCACAAGGCATAAGTCGATGTTAAGGATATATTTGGAAAGACACCACTTATTATGGCA
ATTAACAATATTCAGAGCAACAATCTTGAATTTGTTGAATACTTACTTTCTAATGGTGCT
TCAGCAAACTTTGCTGATAACTATGGCAGAACACCCTTGCATCATGCCATCAATAAGGCT
GATAAAGGTGCCAATGCTTCTTTTGATCTCGAAAATCTCTTGATTAAGAATAAAGCAGAT
ATTAATGCTGCTGACTCTCTTGGTAGAACTCCTCTTCACTATTGTTTTGTTAGCCTCTAA
GATTAGTAATATAGTACATTACAGTATGATCCTTTTGAAACTGTTAGCAGTCTTTGTAAC
CAATCCAATATTAAGATTGACGTTAAAGATAATTTAGGAAAGACTCCTTTGCATTATGCT
GCTTAAAAAAATTCTACTATATCTGTAATCTATATGATCGAAAAGAAAGCTAATATTGAT
ATTGAAGATGCCAATGGTAATACTCCATTAGCTGTCGCTTTCCGTTTCAAAAGAAGTGAA
ATTACTACTACCCTTATTCAAAATGGTGCTAATACTTCAAAGTTCATAACTATTAACAAG
AATTTAAAACCAAACGGGGAAGAAGAGGAAGAATACAAAGAACCTGCTAAAGATCATTGG
GGTAATCCAATCAAAACTAGAAGAAGATAAAACTATTCTAGCTATGGAAGCAGATACTTA
TTCTAATATCAAAATCAATATGATGGATTTGGAGGTGACCAAAATTCAAATAATAGTATC
ATCAAAAAATTACTTAGTGAATACCATATTGAAGAAGACAGTTATATCGAATTAGTTAAA
AGAAGCATCACAAAAGAATAGTTTAAGGAAAAAGGCTTAGATAATCTCGTCTTTTAAGAA
TTTAGAGTAAGAGGTGATTTACCATTAGGTAAGCATTCATTTTTCAAGGCATCTATCACT
TTCTAATGGTAGGGTATTGCCTATTTGCTTTTAATCAAGGGCAATTACAATCTTTTTAAT
GCTTTAGAGGATGCCATTAAAATTGATCTTTATTAACTTTCAATCACTCTTCTTTTTAAG
TATCCAGAAGATGAAACGATTACTTAATGTAATAGCGAAGGACAAAACCTGATACACATT
TTGTGTCAAAGATCTCCTAGAGATGTTAATCTTTAAGTGAAGCTTTTTGAAACTCTTTTG
AATAGAGGTGTTGATGCTAAAAAATTAGATAATAAGAAGAATCTTTGCTTGCATTTTGCT
TTCCTTCATCATTAACTTACTCCCAAACTACTAGAATTAGGATTAGATTGCAATGCCTAC
AATGATGACTAATAAACACCATTTGCCTTAGCTATTTAAGAAGATGCAAAATAAGCATTG
AAAATATATACAGCTAACTACAAACCTGACTATTCTAAAAAATTCAAAGCTAAATTAGAA
GGCCATTAAGACTATTTATAATTTACACCTTTGCTTATTTAATTTGCAAATAAAAATAAA
GATTTAGTTTTATTGAATCATTTATTGGCAAATGGATCAAATATTAACGAAGTTGATAAT
TTAGGTAGAAATGCCCTCTATTATGCTATATATCACAACTCTCACAAATTAGTTAAATTT
GTTCTTTAAACAAAGAAATTCGATGTTAAGCATGTAGATAATCAAGGCAAAAATGCTGTT
CACTACGTTGTTAATCCAGTTGAATTTGGCTCTTATGAAAATACAGAAATATTAGAGCTA
CTTCACAATGCAAAAATAGATTTCAATGTAAAGGATAAGGATGGAAATACTGCAATGTTT
TATGCTTTGCAATAAGATTCCAAAAAAATGGCAGAATCCTTGAAAAAATACGGTGTTGAA
GCTCTTAAAGAAAAGAAATTGCCTTAAAGAGCTGCTACTTCAATAGTAACTGATGCTTTA
TTCCCTGATGAAGAAATTGATTATGAAGAAGACAGTAAGAAGTTTAGCGAAGAAACTACT
TATGATCAATATAAGGAATTCTTTGAGCAAAAGAATGCTGGTGATAAAGTTTATCTCGAT
AAGTATGTAGCTGGAAACTACAAAAAGAAAGATAATTATGTAGTACTTGATGATAATAAT
GAACCATACAACTTGCTCATGACTAAAGTTGATCTCGGAGGAGGATTTGCTAAGTATGTA
TTCTACATCATGTAAGTTATTCATGATAAAAATTCAGACGTTTATATTCTTTACACTCGT
TGGGGTCATATGGGTGGTATGGGTCAAATGCAACACACTCCTTTTGCTACCAAAGAAGCT
GCCGTTAAGGAATTCAGTAAAATTTTCTACTAAAAGTCTGGAAACGATTGGACTAACAGA
CACAACTTCAAAAAATAAGATAAGAAATATTAACTTGTTATCTTCGAGAAAGGAAATGAT
AAAAAATCTTTCTCTTTAAAGCCTTATGACTTTGAACGTCTAAATTGTTCAGCTTCATAG
CTCGAAAAGCCTATTTAAGAGTTTATTAAGAATATTTCTAATGCAGAAATTTTCAAATAA
GCATATCGCCAATTTGCCCTTTCTGACTAATATCTTCCCATAACTAAGCTATCAAAAGCA
GCCTTAATTGAAGCTTAGGGCATTCTTGCAGATATTAGAGAAGAAGTCATAGAAATCTAA
AAATTAAGAAGTAAATTAACTTAAGGAAATAACATGCAACTTCTTTTAGAAAGAGAAGAA
AGCGTACTTCGTTATAGCAATAGATATTATGAACTTGTTCCAAGAGCTGTTTCTAAATGG
GAGCCTGCTCAACCCTTAAACCATGAACATAATATTTCTTAAGAATAGCGTCTTGTTGAA
AATTTACTTGATTTTGAAGCTGCTATTAAGATTATCATGGGTTCTTATACTAAGCTTCAA
GTAATGCATCCTTTGGATTACTGTTTCAACTCATTAAGCATCCGTATGAAATAAATTTAA
AATGAACATCCTGAATATAAAATGATTTAGTAATACGTTTCCAGAACAAATCATAAAGCT
ACTGATCCTAATTCTTAGTTTATTAGAAATGTTTTCGCTGTTGAGAGAAGAGGTGAGGCT
GAAAGAATTAAATAATTCTCTGATCATACTAAAAAGCTTTTATGGCACGGCAGTGGTGTT
TAAAATCTCTTAAGTATTCTTAATTTTGGTTTAAGAATCAATGGTATTCATGCCTAAAAA
TCTGGAAGCTCTCTTGGTGACGGAATCTACTTTGCTGATTTATTCTCCAAGGCAAGTGCT
TATGCTAACAATGCTGATGTTGGTGTCGAATCAAGATTCTTACTTCTTTGTGAAGTTGCA
GTTGGAAAGGAATAACAAATTAAAACTAATGAAAATTTTACTAAGTTTGCTAACTCAAAT
TATTAACTTATGAAAGGCTTTAACAGTGTTAAACTTGTAGGTAAGTCTTGTCCTGATGAA
AAGAAAAATCTTGTTTTACCAAACGGTACTATTGTTCCAATCGGACCAATAATTGATTTC
AATGAAAACTTGAAGTAGAAACTTCAAATAGAGAAATCTACCAAAAAGAGTGCAAAAAAA
TCTACTAAAAAACCTGCTTAGAAAATACCTGCTAGACCTATCAAGAAGGTAGTCAAAGCT
ACTAAATATTCATCAGATGAAGAAAACTCTCAAGATGAAGAAAGCTAAATTTAGGTTGAA
GAAGACGAACTTGATATTCCTGAAGATGAAATTTAATCTGATGGTGATGAGGAAATAGAA
GAGGAAGAAGATAACTTTGATGAAGAATAAGATGAACAAAATCTTTTATAAAATAATTTC
TTATATGACGTACAACACTAAGGTGCTAAGACTCCATTCAATTAGCTCTTTACTCAATAT
TAAAATAGTGAATACGTAGTTTACAACTCAGCTCAAGTTAGAATAAGATATTTAATTGAA
ATAAGAGATTGA


>TTHERM_00502600(protein)
MADKGIFIYAVRDEDSMQGFILVASEVDIDVENSKAEKVGVYHIHSVKNKPYNYTVNKKL
TNVRLDEFMSVVDEDLYEFNEKNRTLVFDKKGYDNLIGQLMDDLEEENDDDSSEEEEKKK
KKPAPKAASARKTRSSKGSDKVKGSDSESYEAADEEDEEEKKRSRGRPKKNKSTEEITED
KDENSQEDQPKPKGKRGRPPSKDKAASVAVPKKQDKQDDKDGEENGEDQNGHEENGDEDK
EEGEQKRVPGKRGRKPGKKTAETPAKKEAQQNIIHNRKPQVFLIQRPGKRGRKPAKKGSE
SEDNEDADDEQEEVSKKGAKKKVEKYKKGSHNPNIPDVVKTDETFEGDSQDINDVCCSFC
TNRELLRAVYTGNSNLLKKLVQSKAKVSTLFAKRGPDADETTLEIILKNKDKKCLDVLIN
ALNKKSEISLASNPECSLEEVYTGFNDRFAYGVPTRKVQMARGGKEGNNAFVADINSFVD
TQSWNENERLIFSLLENETEVQFLEFLRGLKDENLTTSLLEKTYVAVRAGNRKTASYLMK
QANKFGGYGFNNLHEQVLSLDDVSKLDEFKKVSITKKSTGVYSKNSYGFGGAQGIITPIH
CAAINPNPEFIKKLLEISPEFTIPDDLMRKPVHYAATCEGPGPLSYLLKQGVDAREGDKK
KITPLMLACQFGRAKNVEILLDANGKSNPDTRTREGYRAIHYAAHYGHLDCIKLMIEKGG
VEVDSPGPKRMTPLHIATSRGHFEIVEYLLSKGAKVIVKDKFKRSAVIHATANGYLKILS
LILKNGGPFNDPDSSGNYPVHYAAAYGFQACLDLLKQAGADFNPQNSWNLTPLSIAMAKG
HFGMVKKLLNYPECDVNCTDVKGRTIISRATEKLNLNNLSQFEFILKEKKANPNMADLQG
QSPLHYLCNLSKDDYVSKRQNEENAHHVTKKYEEEYEKIVQKATQILLDCGADINKLNTM
EESPLTIAIKQQNFFILNILLKKGGLDFSHVNQIDQNILHTLNTLILEGPSGIDQFYNIF
EEIKKDKNVNLKEYLNKVDYHGFSPLLMYVKIFSENASHYREQRVEELSQEIYSKKGGSA
PNKKNPIKKQAPTRGPRVAKKAIRSAPAKSLIGFSNDGALVQLTEKELEKVQKQADEDLL
QFEQKFQKLITFLVEKGSDVEAKVQKIKKYRSNMDVEDKSDNEEQQEQDEDDDENEGNKT
LKDEMGNPIQNKKVKYIPEYNSCGEMNIFGLALSHLSLPYLKFIHEQYPQLVNNVDYLKR
NHLHKFILKNDDEPATNVSHKVLEWLTTLKIDINQKDIIESTPLISAISQKKYKFAKTLI
NHKAQVDVKDIFGKTPLIMAINNIQSNNLEFVEYLLSNGASANFADNYGRTPLHHAINKA
DKGANASFDLENLLIKNKADINAADSLGRTPLHYCFVSLQDQQYSTLQYDPFETVSSLCN
QSNIKIDVKDNLGKTPLHYAAQKNSTISVIYMIEKKANIDIEDANGNTPLAVAFRFKRSE
ITTTLIQNGANTSKFITINKNLKPNGEEEEEYKEPAKDHWGNPIKTRRRQNYSSYGSRYL
FQYQNQYDGFGGDQNSNNSIIKKLLSEYHIEEDSYIELVKRSITKEQFKEKGLDNLVFQE
FRVRGDLPLGKHSFFKASITFQWQGIAYLLLIKGNYNLFNALEDAIKIDLYQLSITLLFK
YPEDETITQCNSEGQNLIHILCQRSPRDVNLQVKLFETLLNRGVDAKKLDNKKNLCLHFA
FLHHQLTPKLLELGLDCNAYNDDQQTPFALAIQEDAKQALKIYTANYKPDYSKKFKAKLE
GHQDYLQFTPLLIQFANKNKDLVLLNHLLANGSNINEVDNLGRNALYYAIYHNSHKLVKF
VLQTKKFDVKHVDNQGKNAVHYVVNPVEFGSYENTEILELLHNAKIDFNVKDKDGNTAMF
YALQQDSKKMAESLKKYGVEALKEKKLPQRAATSIVTDALFPDEEIDYEEDSKKFSEETT
YDQYKEFFEQKNAGDKVYLDKYVAGNYKKKDNYVVLDDNNEPYNLLMTKVDLGGGFAKYV
FYIMQVIHDKNSDVYILYTRWGHMGGMGQMQHTPFATKEAAVKEFSKIFYQKSGNDWTNR
HNFKKQDKKYQLVIFEKGNDKKSFSLKPYDFERLNCSASQLEKPIQEFIKNISNAEIFKQ
AYRQFALSDQYLPITKLSKAALIEAQGILADIREEVIEIQKLRSKLTQGNNMQLLLEREE
SVLRYSNRYYELVPRAVSKWEPAQPLNHEHNISQEQRLVENLLDFEAAIKIIMGSYTKLQ
VMHPLDYCFNSLSIRMKQIQNEHPEYKMIQQYVSRTNHKATDPNSQFIRNVFAVERRGEA
ERIKQFSDHTKKLLWHGSGVQNLLSILNFGLRINGIHAQKSGSSLGDGIYFADLFSKASA
YANNADVGVESRFLLLCEVAVGKEQQIKTNENFTKFANSNYQLMKGFNSVKLVGKSCPDE
KKNLVLPNGTIVPIGPIIDFNENLKQKLQIEKSTKKSAKKSTKKPAQKIPARPIKKVVKA
TKYSSDEENSQDEESQIQVEEDELDIPEDEIQSDGDEEIEEEEDNFDEEQDEQNLLQNNF
LYDVQHQGAKTPFNQLFTQYQNSEYVVYNSAQVRIRYLIEIRD


>TTHERM_00502600(gene)
ATGGCTGATAAAGGAATTTTTATTTACGCAGTCAGAGATGAAGACAGCATGCAAGGCTTC
ATCTTGGTTGCTAGTGAGGTAGATATTGATGTGGAAAACTCTAAGGCAGAGAAGGTTGGA
GTTTACCATATTCATTCTGTAAAAAATAAACCATACAATTATACAGTCAACAAAAAACTC
ACTAATGTAAGACTTGATGAGTTTATGAGCGTAGTAGATGAGGATTTATATGAGTTTAAT
GAAAAGAATAGAACTCTAGTATTCGATAAGAAAGGTTATGACAACTTAATTGGTTAACTT
ATGGATGATTTAGAAGAAGAAAATGATGATGACTCATCAGAAGAAGAAGAAAAAAAAAAG
AAGAAACCTGCTCCTAAGGCAGCTTCTGCCAGGAAAACTCGTAGTTCTAAGGGATCTGAT
AAGGTTAAGGGATCTGACAGTGAAAGCTATGAGGTAATTAACAAAAAATTAAAATTTCGT
TTTTAATTTCTTAATTTTGTAAAAAGTTTACTATTTTTTAAAACTTAGAATAAAGACATC
AATCAATCAAACGTTTTTATTATTTATTTTGTTCGTTGTCTTATGATTGGATTTCTTAAT
TTATTATAAATTATATGTTCTTATTAGATATTTGCAATCCAATATCAGAAAATAAAATTT
TACAAAAATTTTGTTCATAAACATTACAATTTAATATCTATAAATTTTAAATATCTTTTT
GCTTTTTATTGAGTTGATATAATTTAAAATAAACTAAATAAATAACGTATTATTTTAAAG
GCAGCTGACGAAGAAGATGAAGAAGAAAAAAAGAGATCAAGAGGAAGACCTAAAAAAAAT
AAATCCACTGAAGAAATTACAGAAGATAAAGACGAAAACTCTTAAGAGGATTAACCTAAG
CCTAAAGGAAAAAGAGGAAGACCTCCTTCTAAGGATAAAGCTGCATCAGTCGCTGTTCCA
AAAAAATAGGATAAGTAGGATGATAAAGATGGAGAAGAAAATGGTGAAGATTAAAATGGT
CATGAAGAAAATGGAGATGAAGATAAGGAAGAAGGAGAGTAAAAACGTGTTCCTGGTAAA
CGTGGCAGAAAGCCAGGTAAAAAAACAGCAGAAACACCTGCAAAAAAAGAAGCGTAATAA
AATATTATACATAATAGAAAGCCATAAGTATTTTTAATTTAAAGACCTGGAAAAAGAGGA
AGAAAGCCAGCAAAGAAGGGCTCAGAATCAGAAGATAATGAAGATGCTGATGATGAATAA
GAAGAAGTCTCAAAAAAGGGAGCAAAAAAGAAAGTAGAAAAATATAAGAAAGGTTCACAC
AATCCTAATATACCTGATGTAGTCAAAACTGACGAAACTTTCGAAGGTGATTCTTAAGAT
ATTAATGACGTTTGTTGCTCATTCTGCACAAACAGAGAAGTACTAATTAATTTGAGAAAA
ATTTAAATTTTGAAATTTTAATTAATTAACTAATTAGTTGTTAAGAGCTGTTTACACAGG
TAATAGTAATCTTTTGAAAAAATTAGTTTAGTCAAAAGCAAAGGTAAAGAAATCATTTTA
TTAATGCATAATTTTTATCAAAATCAATACTATTATTAAATAGGTCTCTACTTTGTTTGC
CAAGAGAGGTCCTGATGCTGATGAAACCACACTTGAAATCATTCTTAAAAACAAGGATAA
AAAGTGCCTTGATGTTTTGATTAATGCTCTTAACAAGAAATCAGAAATTTCTTTAGCTTC
TAATCCTGAATGCTCCTTAGAAGAAGTCTATACTGGTTTCAATGACAGATTTGCATACGG
TGTACCAACTAGAAAGGTATAAATGGCTAGAGGTGGTAAAGAAGGAAACAATGCTTTTGT
TGCAGATATTAACTCATTTGTTGATACCTAAAGCTGGAATGAGAATGAAAGATTAATCTT
TTCTCTTCTTGAGAATGAAACAGAAGTTTAATTTTTGGAATTCTTAAGAGGTCTTAAAGA
CGAAAATCTCACTACCTCTTTACTTGAAAAAACATATGTTGCTGTAAGAGCTGGTAATAG
AAAGACTGCATCCTATTTGATGAAATAAGCTAATAAATTCGGTGGATATGGATTCAACAA
TCTTCATGAATAGGTTTTATCCTTAGATGATGTATCCAAATTAGATGAATTCAAAAAAGG
TAAATTCATTTTTAAGATAAACCAAAAATGCATGAATTTTTTAAAGTAAGTATAACCAAG
AAAAGCACAGGTGTTTATAGCAAGAATAGTTATGGTTTTGGAGGTGCATAGGGTATTATT
ACTCCTATTCATTGTGCAGCCATCAATCCTAATCCAGAATTCATCAAAAAGTTGTTAGAA
ATATCACCTGAATTCACAATTCCCGATGATTTAATGAGAAAGCCAGTTCACTATGCAGCA
ACTTGCGAAGGTATTTATTTAACTCATACTTGCCTTTAAAAATATTTATAATAAATAAAT
AAACATAATTTAAAAATAGGTCCTGGTCCTCTTAGTTATCTTTTAAAATAGGGTGTTGAT
GCAAGAGAAGGTGATAAGAAAAAAATTACACCTTTAATGCTTGCTTGTTAATTTGGTAGA
GCCAAGAATGTAGAAATTTTGTTAGATGCAAATGGCAAATCAAACCCTGATACTCGTACT
AGAGAAGGTTACAGAGCTATTCATTATGCAGCCCACTATGGACATCTTGACTGTATTAAA
TTGATGATTGAAAAAGGTGGTGTTGAAGTTGATTCTCCTGGTCCCAAAAGAATGACACCT
CTCCATATTGCTACTTCAAGAGGTCATTTTGAGATCGTGGAATATCTTCTTTCAAAAGGA
GCTAAAGTTATTGTAAAAGATAAGTTTAAACGTAGTGCAGTCATTCATGCTACTGCTAAT
GGCTATCTTAAGATTTTAAGTCTTATTTTAAAGAATGGTGGACCATTCAATGACCCAGAT
TCCTCAGGTAACTATCCTGTACATTATGCAGCTGCATATGGATTTTAAGCTTGTCTTGAT
TTACTCAAATAAGCTGGAGCTGACTTTAATCCTCAAAATTCTTGGAATTTAACTCCTCTC
TCAATTGCTATGGCTAAAGGTAATAAATAGATTTAAATAATTTTTTTAAGTAATTTAAAA
ATATAAATAATTTAGGACATTTTGGAATGGTTAAGAAGCTCTTAAATTATCCTGAATGCG
ATGTTAACTGCACTGATGTTAAAGGTAGAACTATCATATCAAGAGCTACTGAAAAATTAA
ATCTAAATAATCTCTCTCAATTCGAATTCATTCTCAAAGAGAAGAAAGCAAATCCTAATA
TGGCTGATTTACAAGGTCAATCGCCTCTTCATTATCTTTGTAACTTATCAAAAGATGATT
ATGTTAGCAAAAGATAGAATGAAGAAAATGCTCATCATGTTACTAAAAAATATGAAGAAG
AATATGAAAAGATTGTCTAAAAAGCTACTTAAATTTTACTTGATTGTGGAGCTGATATTA
ACAAATTAAACACTATGGAAGAATCTCCATTAACTATTGCTATCAAATAATAGAATTTCT
TTATTTTAAATATTTTATTAAAGAAAGGAGGCCTCGATTTCTCTCATGTTAACTAAATTG
ATCAAAATATTCTACACACCTTAAATACTTTAATTTTAGAAGGACCAAGTGGAATCGATC
AATTCTATAATATCTTTGAAGAAATCAAAAAAGATAAAAACGTAAATCTTAAAGAATACT
TGAATAAAGTTGATTATCATGGTTTTTCACCTTTGTTAATGTACGTTAAAATATTCAGTG
AAAGTAAATTTTTAAAGCTTATTATATTAAAATAATTTTTGTATTTATTTATTTCTTTAT
TTAAATTTTATAAAAAGATGCTTCTCATTATAGAGAATAAAGAGTTGAGGAATTAAGCCA
AGAAATATACTCTAAGAAAGGAGGCTCAGCACCTAATAAAAAGAATCCTATCAAAAAGTA
AGCCCCTACAAGAGGTCCTAGAGTAGCAAAAAAAGCAATTAGAAGTGCACCAGCAAAATC
ATTAATTGGATTTAGCAATGATGGAGCCTTAGTTTAATTAACAGAAAAGGAATTAGAAAA
AGTTTAAAAACAAGCTGATGAAGATTTATTGCAATTTGAGCAAAAATTCTAAAAATTAAT
TACTTTCTTGGTCGAAAAGGGTTCAGATGTAGAAGCTAAAGTTTAAAAAATTAAAAAATA
TAGATCAAACATGGATGTAGAAGATAAATCAGATAATGAAGAATAATAAGAATAAGACGA
AGATGATGATGAAAATGAAGGAAATAAAACCTTAAAAGATGAGATGGGTAATCCAATTTA
AAATAAAAAAGTTAAGTACATTCCAGAATATAATTCTTGTGGAGAAATGAATATATTTGG
ATTAGCTCTTAGCCACCTATCTTTACCTTACTTAAAATTCATTCATGAATAGTATCCTTA
ATTAGTTAACAACGTTGATTATCTCAAGAGAAATCATCTCCATAAATTTATTTTGAAAAA
TGATGATGAACCAGCTACAGTAAACAAGATATTTGTTTAAATTTTCTTAATTTAATTTAA
AAATTTTTATAATTAGAACGTTTCTCATAAAGTTTTAGAGTGGCTCACTACTTTAAAGAT
AGATATTAATTAAAAAGATATTATTGAATCAACTCCTTTAATCTCAGCTATTTCTTAGAA
AAAGTACAAGTTTGCAAAGACTCTTATTAATCACAAGGCATAAGTCGATGTTAAGGATAT
AGTAAATTAATTAACAAAATATTTTTATCGAAGCAACATTTTTTTTTTTGAAAACAGTTT
GGAAAGACACCACTTATTATGGCAATTAACAATATTCAGAGCAACAATCTTGAATTTGTT
GAATACTTACTTTCTAATGGTGCTTCAGCAAACTTTGCTGATAACTATGGCAGGTAAAAT
GAATATACTTTAAATACTTTTTTTAAACTAATTTTAATTAAATAGAACACCCTTGCATCA
TGCCATCAATAAGGCTGATAAAGGTGCCAATGCTTCTTTTGATCTCGAAAATCTCTTGAT
TAAGAATAAAGCAGATATTAATGCTGCTGACTCTCTTGGTAGAACTCCTCTTCACTATTG
TTTTGTTAGCCTCTAAGATTAGTAATATAGTACATTACAGTATGATCCTTTTGAAACTGT
TAGCAGTCTTTGTAACCAATCCAATATTAAGATTGACGTTAAAGATAATTTAGGAAAGAC
TCCTTTGCATTATGCTGCTTAAAAAAATTCTACTATATCTGTAATCTATATGATCGAAAA
GAAAGCTAATATTGATATTGAAGATGCCAATGGTAATACTCCATTAGCTGTCGCTTTCCG
TTTCAAAAGAAGTGAAATTACTACTACCCTTATTCAAAATGGTGCTAATACTTCAAAGTT
CATAACTATTAACAAGAATTTAAAACCAAACGGGGAAGAAGAGGAAGAATACAAAGAACC
TGCTAAAGATCATTGGGGTAATCCAATCAAAACTAGAAGAAGATAAAACTATTCTAGCTA
TGGAAGCAGATACTTATTCTAATATCAAAATCAATATGATGGATTTGGAGGTGACCAAAA
TTCAAATAATAGTATCATCAAAAAATTACTTAGTGAATACCATATTGAAGAAGACAGTTA
TATCGAATTAGTTAAAAGAAGCATCACAAAAGAATAGTTTAAGGAAAAAGGCTTAGATAA
TCTCGTCTTTTAAGAATTTAGAGTAAGAGGTGATTTACCATTAGGTAAGCATTCATTTTT
CAAGGCATCTATCACTTTCTAATGGTAGGGTATTGCCTATTTGCTTTTAATCAAGGGCAA
TTACAATCTTTTTAATGCTTTAGAGGATGCCATTAAAATTGATCTTTATTAACTTTCAAT
CACTCTTCTTTTTAAGTATCCAGAAGATGAAACGATTACTTAATGTAATAGCGAAGGACA
AAACCTGATACACATTTTGTGTCAAAGATCTCCTAGAGATGTTAATCTTTAAGTGAAGCT
TTTTGAAACTCTTTTGAATAGAGGTGTTGATGCTAAAAAATTAGATAATAAGAAGAATCT
TTGCTTGCATTTTGCTTTCCTTCATCATTAACTTACTCCCAAACTACTAGAATTAGGATT
AGATTGCAATGCCTACAATGATGACTAATAAACACCATTTGCCTTAGCTATTTAAGAAGA
TGCAAAATAAGCATTGAAAATATATACAGCTAACTACAAACCTGACTATTCTAAAAAATT
CAAAGCTAAATTAGAAGGCCATTAAGACTATTTATAATTTACACCTTTGCTTATTTAATT
TGCAAATAAAAATAAAGATTTAGTTTTATTGAATCATTTATTGGCAAATGGATCAAATAT
TAACGAAGTTGATAATTTAGGTAGAAATGCCCTCTATTATGCTATATATCACAACTCTCA
CAAATTAGTTAAATTTGTTCTTTAAACAAAGAAATTCGATGTTAAGCATGTAGATAATCA
AGGCAAAAATGCTGTTCACTACGTTGTTAATCCAGTTGAATTTGGCTCTTATGAAAATAC
AGAAATATTAGAGCTACTTCACAATGCAAAAATAGATTTCAATGTAAAGGATAAGGATGG
GTAAATATTTTTTGTTGTTGTAAATATAAATTTAATAATTCATTTTAAATTAGAAATACT
GCAATGTTTTATGCTTTGCAATAAGATTCCAAAAAAATGGCAGAATCCTTGAAAAAATAC
GGTGTTGAAGCTCTTAAAGAAAAGAAATTGCCTTAAAGAGCTGCTACTTCAATAGTAACT
GATGCTTTATTCCCTGATGAAGAAATTGATTATGAAGAAGACAGTAAGAAGTTTAGCGAA
GAAACTACTTATGATCAATATAAGGTTAATACAAAAATTAAGTCAAACAAAATTTAATAT
TTATGATTTTATTAAAAGGAATTCTTTGAGCAAAAGAATGCTGGTGATAAAGTTTATCTC
GATAAGTATGTAGCTGGAAACTACAAAAAGAAAGATAATTATGTAGTACTTGATGATAAT
AATGAACCATACAACTTGCTCATGACTAAAGTTGATCTCGGAGGAGGATTTGCTAAGTAT
GTATTCTACATCATGTAAGTTATTCATGATAAAAATTCAGACGTTTATATTCTTTACACT
CGTTGGGGTCATATGGGTGGTATGGGTCAAATGCAACACACTCCTTTTGCTACCAAAGAA
GCTGCCGTTAAGGAATTCAGTAAAATTTTCTACTAAAAGGTAACTTAAATTCAAACTTTA
TAATTGTTGAATTAAATTTATTTTATGAATAATTTTTAAATTAGTCTGGAAACGATTGGA
CTAACAGACACAACTTCAAAAAATAAGATAAGAAATATTAACTTGTTATCTTCGAGAAAG
GAAATGATAAAAAATCTTTCTCTTTAAAGCCTTATGACTTTGAACGTCTAAATTGTTCAG
CTTCATAGCTCGAAAAGCCTATTTAAGAGTTTATTAAGAATATTTCTAATGCAGAAATTT
TCAAATAAGCATATCGCCAATTTGCCCTTTCTGACTAATATCTTCCCATAACTAAGCTAT
CAAAAGCAGCCTTAATTGAAGCTTAGGGCATTCTTGCAGATATTAGAGAAGAAGTCATAG
AAATCTAAAAATTAAGAAGTAAATTAACTTAAGGAAATAACATGCAACTTCTTTTAGAAA
GAGAAGAAAGCGTACTTCGTTATAGCAATAGATATTATGAACTTGTTCCAAGAGCTGTTT
CTAAATGGTAAGTTTATTAAAGTTAAAAAATAGTTTTAATTTGTTAAAAATAATCAATAA
ATAAATAGGGAGCCTGCTCAACCCTTAAACCATGAACATAATATTTCTTAAGAATAGCGT
CTTGTTGAAAATTTACTTGATTTTGAAGCTGCTATTAAGATTATCATGGGTTCTTATACT
AAGCTTCAAGTAATGCATCCTTTGGATTACTGTTTCAACTCATTAAGCATCCGTATGAAA
TAAATTTAAAATGAACATCCTGAATATAAAATGATTTAGTAATACGTTTCCAGAACAAAT
CATAAAGCTACTGATCCTAATTCTTAGTTTATTAGAAATGTTTTCGCTGTTGAGAGAAGA
GGTAATTTTATAAAAAATATTAATATCATTAAATATTTTATTTATAATTTTAAAAAGGTG
AGGCTGAAAGAATTAAATAATTCTCTGATCATACTAAAAAGCTTTTATGGCACGGCAGTG
GTGTTTAAAATCTCTTAAGTATTCTTAATTTTGGTTTAAGAATCAATGGTATTCATGCCT
AAAAATCTGGAAGCTCTCTTGGTGACGGAATCTACTTTGCTGATTTATTCTCCAAGGCAA
GTGCTTATGCTAACAATGCTGATGTTGGTGTCGAATCAAGGTATATAACAAATAAATTTA
CATGTATAAAGTTAATATTTATTTTTAATTAAATTGTAGATTCTTACTTCTTTGTGAAGT
TGCAGTTGGAAAGGAATAACAAATTAAAACTAATGAAAATTTTACTAAGTTTGCTAACTC
AAATTATTAACTTATGAAAGGCTTTAACAGTGTTAAACTTGTAGGTAAGTCTTGTCCTGA
TGAAAAGAAAAATCTTGTTTTACCAAACGGTACTATTGTTCCAATCGGACCAATAATTGA
TTTCAATGAAAACTTGAAGTAGAAACTTCAAATAGAGAAATCTACCAAAAAGAGTGCAAA
AAAATCTACTAAAAAACCTGCTTAGAAAATACCTGCTAGACCTATCAAGAAGGTAGTCAA
AGCTACTAAATATTCATCAGATGAAGAAAACTCTCAAGATGAAGAAAGCTAAATTTAGGT
TGAAGAAGACGAACTTGATATTCGTAAAATCACAAAAAAAAAAATAAATTTTAATAACTT
TTTTTTTTTTAAATTTAAGCTGAAGATGAAATTTAATCTGATGGTGATGAGGAAATAGAA
GAGGAAGAAGATAACTTTGATGAAGAATAAGATGAACAAAATCTTTTATAAAATAATTTC
TTATATGACGTACAACACTAAGGTGCTAAGACTCCATTCAATTAGCTCTTTACTCAATAT
TAAAATAGTGAATACGTAGTTTACAACTCAGCTCAAGTTAGAATAAGATATTTAATTGAA
ATAAGAGATTGA