Identifiers and Description

Gene Model Identifier

TTHERM_00865150

Standard Name

PARP5 (Poly [ADP-Ribose] Polymerase 5)

Aliases

PreTt29145 | 154.m00103 | 3751.m00449

Description

WGR domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00865150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19683.19.997093137033517e-262hypothetical protein (639 aa)
OxytrichaContig22016.0.g202.000341663036036e-86Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02787412.998830401637127e-79adprt1A on chromosome: 3 posit
ion 1394183 to 1397588
WormBaseWBGene000040493.0013199058937152e-77locus:pme-1 Poly(ADP-ribose)
polymerase pme-1 status:Con
firmed UniProt:Q9N4H4 prot
ein_id:CCD73512.1
Stentor CoeruleusSteCoe_279845.301718666092324e-65

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865150(coding)
ATGGACGTTGAACCAAGCTAGCCAATAGAATTAGAGTTCGTAGAAGAAGGAGAAGAGGAT
GAGATATTTAAAAAATAAAATAAAAATCAACTGAATACTTCAGCAAACAAATCTATTTCT
AAAGCAGAATTGCTAAATTTTATATCTAGTAAAAATAATACAACTAAGAAATCTACTTAA
AAAGATATGATAAACGAAGATATAAGCATATAAGAAAGTGAATAAAAAAAAAGTTAAAGT
GTTGAAGACTTAGAGATAGAATTAGAAATAGAAAATGATATTTTTGAATAACCTAATAAG
TAAAACAATTCTTAAATATAAAATACGATTGAAGAAGTTAGCTCTGATAATTTGGGAAAC
AAAATATAAAAACTTGATCTTAAAGAAGGAGATTTGTTATAAAAGCAAAAAAAAAAGCAA
AGGACTGATGGATATTAAGTTTATGAGACTTTTACATGCATGTTAAATTTAACAGATATT
TCTTATGGTGAAAAAGGTCATAATAAATTCTATTAGATTGAAGTCTTGCATAAAGGGTAT
TCGATATTTACTTTATATACAAAATGGGGTAGAGTAGGAGCATAAAATCCTTAGGAAAGC
TACAAGAGAATGGATAATAAGTATGATGCAATTTTAGGTTTTAAAAAGAAATTTTATGAT
AAAACACATAACGATTGGACTGGTATATTTTCAGATTTTAAGCCTTAACCTGGTAAATAT
ACATGGATTCAAGTAGATGCCTCATCAGGTGGATCAAAAAACTCAGTAAATGAAGATATC
GAAAGAATAAATAAAAGAAACGCAGAGTTAAAAAAGAGAATGAATTCTAATACAAGCAAA
CTAGAAAGTTCAATTAAAGATTTAATGCTATTAATATGGGACTTTAATAGAATTAATAAG
ACATTAAAAGAATTAAATTTCGACACTGAGAAGAATCCTCTAGGTCGTTTAACATTCGAT
CAAGTACAAAAAGGTTATAAAATTTTGACTGAAATTTAGAATGCTTTGTTGTAAGGCTCA
AGGACATCGATTATCATAGAATTGACAAACCAATTTTACACAAATATACCTCAAAACTAT
GGTATGAGGGCTCTTCCTATGATTGATCATATGACTAAAGTAAAGGAAAAATTGCACTTG
TTAGACGTTTTAAAAGAGATAGATATTACTAATAGATATATGAACTAGGCTTTCTAAGCA
TAAGGAGCAGAAAGTATTAATCCTCTTGATACCTTTTATAGTATGCTTAAATGCAATATA
AATCAAGTAGATTAGTAATCTTAGACATATCAAGTAATTTAGAAAATGGTTGAAAATACT
CATGGACCATCTCACGAAAAATTTAAACTCAAGATAGTAGATATTTATGAATTAAATAGA
AATTAAGAAAGCCAGAGATTCTTCCCTTTTAAATAGCTTCCAAATTAAACATTATTATGG
CACGGTTCTAGAATTTCTAATTTCGTAGGTATATTGAGTGAAGGATTAAGAATTGCTCCT
CCTGAGGCACCTATGACAGGTTATATGTTTGGAAAAGGAATTTATATGGCTGACGTAGTT
TCCAAGGCAGCAGGTTATTGTCATGCCAAATTAGATTCTCCAGAAGGATTGCTTGTCTTA
TGTGAGGCAGCACTAGGATAGATATACGAATGTAATAAAGCTAAATCCTTTAAAAAGCCT
CCTTAGTATTATCATAGTGTTAAAGGCGTTGGTAAATATAAAACCCAATCAGAAGGAATA
TAAAAAATAGGAACTACTCAATGTTTTGCAGGAAAAGTTGTAGAAAGTGACGAAAATGGA
GATGGCTAGCCAAAGGATTTAGTATATAATGAATATATTATTTATGACACATCTTAAGTT
AAAATGAAATATTTAATACGTGTTAATTTCGAGTTTTTGTGA


>TTHERM_00865150(protein)
MDVEPSQPIELEFVEEGEEDEIFKKQNKNQLNTSANKSISKAELLNFISSKNNTTKKSTQ
KDMINEDISIQESEQKKSQSVEDLEIELEIENDIFEQPNKQNNSQIQNTIEEVSSDNLGN
KIQKLDLKEGDLLQKQKKKQRTDGYQVYETFTCMLNLTDISYGEKGHNKFYQIEVLHKGY
SIFTLYTKWGRVGAQNPQESYKRMDNKYDAILGFKKKFYDKTHNDWTGIFSDFKPQPGKY
TWIQVDASSGGSKNSVNEDIERINKRNAELKKRMNSNTSKLESSIKDLMLLIWDFNRINK
TLKELNFDTEKNPLGRLTFDQVQKGYKILTEIQNALLQGSRTSIIIELTNQFYTNIPQNY
GMRALPMIDHMTKVKEKLHLLDVLKEIDITNRYMNQAFQAQGAESINPLDTFYSMLKCNI
NQVDQQSQTYQVIQKMVENTHGPSHEKFKLKIVDIYELNRNQESQRFFPFKQLPNQTLLW
HGSRISNFVGILSEGLRIAPPEAPMTGYMFGKGIYMADVVSKAAGYCHAKLDSPEGLLVL
CEAALGQIYECNKAKSFKKPPQYYHSVKGVGKYKTQSEGIQKIGTTQCFAGKVVESDENG
DGQPKDLVYNEYIIYDTSQVKMKYLIRVNFEFL


>TTHERM_00865150(gene)
ATGGACGTTGAACCAAGCTAGCCAATAGAATTAGAGTTCGTAGAAGAAGGAGAAGAGGAT
GAGATATTTAAAAAATAAAATAAAAATCAACTGAATACTTCAGCAAACAAATCTATTTCT
AAAGCAGAATTGCTAAATTTTATATCTAGTAAAAATAATACAACTAAGAAATCTACTTAA
AAAGATATGATAAACGAAGATATAAGCATATAAGAAAGTGAATAAAAAAAAAGTTAAAGT
GTTGAAGACTTAGAGATAGAATTAGAAATAGAAAATGATATTTTTGAATAACCTAATAAG
TAAAACAATTCTTAAATATAAAATACGATTGAAGAAGTTAGCTCTGATAATTTGGGAAAC
AAAATATAAAAACTTGATCTTAAAGAAGGAGATTTGTTATAAAAGCAAAAAAAAAAGCAA
AGGACTGATGGATATTAAGTTTATGAGACTTTTACATGCATGTTAAATTTAACAGATATT
TCTTATGGTGAAAAAGGTCATAATAAATTCTATTAGATTGAAGTCTTGCATAAAGGGTAT
TCGATATTTACTTTATATACAAAATGGGGTAGAGTAGGAGCATAAAATCCTTAGGAAAGC
TACAAGAGAATGGATAATAAGTATGATGCAATTTTAGGTTTTAAAAAGAAATTTTATGAT
AAAACACATAACGATTGGACTGGTATATTTTCAGATTTTAAGCCTTAACCTGGTAAATAT
ACATGGATTCAAGTAGATGCCTCATCAGGTGGATCAAAAAACTCAGTAAATGAAGATATC
GAAAGAATAAATAAAAGAAACGCAGAGTTAAAAAAGAGAATGAATTCTAATACAAGCAAA
CTAGAAAGTTCAATTAAAGATTTAATGCTATTAATATGGGACTTTAATAGAATTAATAAG
ACATTAAAAGAATTAAATTTCGACACTGAGAAGAATCCTCTAGGTCGTTTAACATTCGAT
CAAGTACAAAAAGGGTATTAGCTAATCTGAATTTGTATTTATAAAATAGAATGATAATTA
TGATTTTTTAAATATAATAATAGTTATAAAATTTTGACTGAAATTTAGAATGCTTTGTTG
TAAGGCTCAAGGACATCGATTATCATAGAATTGACAAACCAATTTTACACAAATATACCT
CAAAACTATGGTATGAGGGCTCTTCCTATGATTGATCATATGACTAAAGTAAAGGAAAAA
TTGCACTTGTTAGACGTTTTAAAAGAGATAGATATTACTAATAGATATATGAACTAGGCT
TTCTAAGCATAAGTAAATAAATAAATAGCTAACTTTCATTATTTACTAAATAAACAAAGT
TTTTTAATTGAATTTTTAATATATGTAATATTTATAAGGGAGCAGAAAGTATTAATCCTC
TTGATACCTTTTATAGTATGCTTAAATGCAATATAAATCAAGTAGATTAGTAATCTTAGA
CATATCAAGTAATTTAGAAAATGGTTGAAAATACTCATGGACCATCTCACGAAAAATTTA
AACTCAAGATAGTAGATATTTATGAATTAAATAGAAATTAAGAAAGCCAGAGATTCTTCC
CTTTTAAATAGCTTCCAAATTAAAGTAAGGCATTTATTTAAACTTCGATAATCTAATTAT
TTTTATTTATCAAAAAAAAGCATTATTATGGCACGGTTCTAGAATTTCTAATTTCGTAGG
TATATTGAGTGAAGGATTAAGAATTGCTCCTCCTGAGGCACCTATGACAGGTTATATGTT
TGGAAAAGGAATTTATATGGCTGACGTAGTTTCCAAGGCAGCAGGTTATTGTCATGCCAA
ATTAGATTCTCCAGAAGGATTGCTTGTCTTATGTGAGGCAGCACTAGGATAGATATACGA
ATGTAATAAAGCTAAATCCTTTAAAAAGCCTCCTTAGTATTATCATAGTGTAATTTTTTT
TAAATATTAAATCCAAAAATTACATTATTAAAAAATAAAAGGTTAAAGGCGTTGGTAAAT
ATAAAACCCAATCAGAAGGAATATAAAAAATAGGAACTACTCAATGTTTTGCAGGTAAAA
TTTAATTTTTTAGTGATAATTATTAAAAAAATAAATAAAATCTATAATTTCTTAAGGAAA
AGTTGTAGAAAGTGACGAAAATGGAGATGGCTAGCCAAAGGATTTAGTATATAATGAATA
TATTATTTATGACACATCTTAAGTTAAAATGAAATATTTAATACGTGTTAATTTCGAGTT
TTTGTGA