Identifiers and Description

Gene Model Identifier

TTHERM_00823980

Standard Name

PARP4 (poly [ADP-ribose] polymerase 4)

Aliases

PreTt20466 | 141.m00123 | 3682.m00057

Description

WGR domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05406 ) WGR domain
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( PF02877 ) Poly(ADP-ribose) polymerase, regulatory domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00823980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18135.19.997093137033517e-262WGR domain-containing protein
(614 aa)
OxytrichaContig12012.0.g598.000542080162695e-100Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02928206.997716170296885e-95adprt2 on chromosome: 6 positi
on 2124835 to 2127096
WormBaseWBGene000040496.996751372006089e-64locus:pme-1 Poly(ADP-ribose)
polymerase pme-1 status:Con
firmed UniProt:Q9N4H4 prot
ein_id:CCD73512.1
Stentor CoeruleusSteCoe_271803.4811068399043105e-57

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00823980(coding)
ATGCCTCCTAAAAGAGCTACTAGATCTTAATCTGCAGCAGCAGCAACTAAAGGTAAATAG
GCTGCTACAAAAACTACAAAAAAAGATGCCAAGATTGAGGATAAAAAAGTGACTAGAGGA
AGAAAAGCAGCCACTAAATCTCCTTCTCCTTCCCCTTCACCTAAAAAAACCCAAAAAGGT
AAACCTGCAGCAGCTTCTAAATCTAAATCTAAAGATACTAAAGTCGCAACAGTAGATAAG
AAAAACACAAAAGCAGCTTAGAAAACTACTTAAAAAACAAAGTAAGCAAAAACAGCACCA
GCACCTTCTCCCAAAAAAACCAATAAAAGAAAAGCTAAGAGTGTATCTCCCTCCCCAGAT
ACAAAGGCCTAAACTAAAAAGAGTCCTGTCAAAAAAGTCAAAGATGTACCCAAAAAAGAT
GAATCTGAAGATGAGAAAAAAACTGTTAAATAGATCGTTAAAGGTAAATGTGCAGTTGAT
TAGTATGTACCAAATTCAACACAATACACAGTTCTATAAGAAGGAAACTAAATTTACAAT
CTTACTTTGAATCAATCAAATGTTGATGCAAACAATAACAAATTCTATCTTGGATAGGTG
CTTGTTAAAGATGGAACTAATCAATACTCCGTTTTCTTTAGATGGGGAAGAGTTGGTGTT
CCAGGACAATAAAGCATTAAAGTTTGTTCAAGTAAATTTGAAGCTATTAGCGAATTCTAA
AAAAAGAAAAGCGATAAAATTAAAGGAGGTTATACTGAAATTTTCATCAAATATGGTGAA
GATGATGAAGATGAAAAGCCAAAGAAAAAATAAACTACTTAACCTACAAAGAGAAAAGAT
TGTACTTTATCTGCTGCAGTTCAAACCTTGATAAACGACATTTTTGATATGAAAATGATT
GAGAGTACAATTAAAGAAATAGGTTATGATTCTAAAAAGATGCCTTTAGGTAAACTTGAC
GATAAAACAATTAAATAAGCTTACACTGTTCTCAAAGATCTTTTAGATGCTGTAAAAAAT
AATAAAGTTAGTGATTATGGTCGTTATTCTAGTTAATTCTACTCCCTTATTCCTCATGAT
TTTGGTTTCTAAAAAATGAGTAACTTCATTTTAAAAACTGAGGAATAAGTGCGTAAGAAG
CTTTCAATGCTTTAAGATTTATCTGACTTAAAAATTGCAACTCAATTACTTAAAGAATCA
GATTCAGATGACTCAATCTTAGATTAAAACTATAAAAAATTAAATGCAGAAATAAAAGAA
GTCACAGATAAAAAGACATTAGACATTATTAAGAATTATGTTAATCAAGGCAAAGGACAT
TATAGCCCTAAGATTTTAGAAATATTTTCAGTAAAAAGAAAAGGCGAGCAAGAACGTTAC
TCAAAAAATATTGGAAACGATACACTCTTATGGCATGGGTCCCGTATTTCAAACTTTGTT
GGTATATTATCTTAAGGTCTTCGTATTGCTCCTCCTGAGGCTCCTGTTACTGGTTATAAT
TATGGTAAGGGTATTTACCTTGCAGATTAATTTACTAAATCTTGTGATTATTGTGCAGGT
AATAGTGATGGTATCCATTACATCATGCTCATAAAGGCTGCTCTAGGAACTCCTAACAAA
ATAGAAAAAACTGATTATAATGCTAATAATCTTCCTAAAGGAACTCATTCTTGCTGGGGT
TGGGGTACTCATGGTCCTGAAGAATTCATAACATTTAATGGAGTTAAAGTACCTAAAGGC
TAGGAAGTTAGAACTAAATCTAAGCACTATATGAAATATAACGAGTTTATCATTTATGAT
ATTGCTTAAGCTCAAATAGATTATCTAATTAGATTTAAAAAGTACTGA


>TTHERM_00823980(protein)
MPPKRATRSQSAAAATKGKQAATKTTKKDAKIEDKKVTRGRKAATKSPSPSPSPKKTQKG
KPAAASKSKSKDTKVATVDKKNTKAAQKTTQKTKQAKTAPAPSPKKTNKRKAKSVSPSPD
TKAQTKKSPVKKVKDVPKKDESEDEKKTVKQIVKGKCAVDQYVPNSTQYTVLQEGNQIYN
LTLNQSNVDANNNKFYLGQVLVKDGTNQYSVFFRWGRVGVPGQQSIKVCSSKFEAISEFQ
KKKSDKIKGGYTEIFIKYGEDDEDEKPKKKQTTQPTKRKDCTLSAAVQTLINDIFDMKMI
ESTIKEIGYDSKKMPLGKLDDKTIKQAYTVLKDLLDAVKNNKVSDYGRYSSQFYSLIPHD
FGFQKMSNFILKTEEQVRKKLSMLQDLSDLKIATQLLKESDSDDSILDQNYKKLNAEIKE
VTDKKTLDIIKNYVNQGKGHYSPKILEIFSVKRKGEQERYSKNIGNDTLLWHGSRISNFV
GILSQGLRIAPPEAPVTGYNYGKGIYLADQFTKSCDYCAGNSDGIHYIMLIKAALGTPNK
IEKTDYNANNLPKGTHSCWGWGTHGPEEFITFNGVKVPKGQEVRTKSKHYMKYNEFIIYD
IAQAQIDYLIRFKKY


>TTHERM_00823980(gene)
ATGCCTCCTAAAAGAGCTACTAGATCTTAATCTGCAGCAGCAGCAACTAAAGGTAAATAG
GCTGCTACAAAAACTACAAAAAAAGATGCCAAGATTGAGGATAAAAAAGTGACTAGAGGA
AGAAAAGCAGCCACTAAATCTCCTTCTCCTTCCCCTTCACCTAAAAAAACCCAAAAAGGT
AAACCTGCAGCAGCTTCTAAATCTAAATCTAAAGATACTAAAGTCGCAACAGTAGATAAG
AAAAACACAAAAGCAGCTTAGAAAACTACTTAAAAAACAAAGTAAGCAAAAACAGCACCA
GCACCTTCTCCCAAAAAAACCAATAAAAGAAAAGCTAAGAGTGTATCTCCCTCCCCAGAT
ACAAAGGCCTAAACTAAAAAGAGTCCTGTCAAAAAAGTCAAAGATGTACCCAAAAAAGAT
GAATCTGAAGATGAGAAAAAAACTGTTAAATAGATCGTTAAAGGTATTTAATTGATATTA
AATAATTAACATAAAAATAATCATTATATTACTGGTATCATTTATATTTAATACTTAAAT
ATTTTTTATAAAGGTAAATGTGCAGTTGATTAGTATGTACCAAATTCAACACAATACACA
GTTCTATAAGAAGGAAACTAAATTTACAATCTTACTTTGAATCAATCAAATGTTGATGCA
AACAATAACAAATTCTATCTTGGATAGGTGCTTGTTAAAGATGGAACTAGTATAAATCCT
ATTTTTTTAAAAAAAATATATTAAATTTATTTCTATAAAAAGATCAATACTCCGTTTTCT
TTAGATGGGGAAGAGTTGGTGTTCCAGGACAATAAAGCATTAAAGTTTGTTCAAGTAAAT
TTGAAGCTATTAGCGAATTCTAAAAAAAGAAAAGCGATAAAATTAAAGGAGGTTATACTG
AAATTTTCATCAAATATGGTGAAGATGATGAAGATGAAAAGCCAAAGAGTAATTTTAATA
GAATTAATTAATTAATTTATTTATTTATTTTTAAAAATGTGTTGAAATTAGAAAAATAAA
CTACTTAACCTACAAAGAGAAAAGATTGTACTTTATCTGCTGCAGTTCAAACCTTGATAA
ACGACATTTTTGATATGAAAATGATTGAGAGTACAATTAAAGAAATAGGTTATGATTCTA
AAAAGATGCCTTTAGGTAAACTTGACGATAAAACAATTAAATAAGCTTACACTGTTCTCA
AAGATGTAACTAGAAATTAAAAACACTTAAAATTTAAATTTAAAATACCTTTTATGTGAT
ATTAAATAGCTTTTAGATGCTGTAAAAAATAATAAAGTTAGTGATTATGGTCGTTATTCT
AGTTAATTCTACTCCCTTATTCCTCATGATTTTGGTTTCTAAAAAATGAGTAACTTCATT
TTAAAAACTGAGGAATAAGTGCGTAAGAAGCTTTCAATGCTTTAAGATTTATCTGACTTA
AAAATTGCAACTCAATTACTTAAAGAATCAGATTCAGATGACTCAATCTTAGATTAAAAC
TATAAAAAATTAAATGCAGAAATAAAAGAAGTCACAGATGTAAACATTTAAATTATTTTA
GTTAAAAGAAATTGAGATAAAAATATCTTATCATTTTTAATGTTTGTTTTAAGCTTTAAA
AAAATAAATTCTAATATCTTCAAATTTGAGAAAAGTTTAATGAAGAAAATATACAACTAA
GCAAGCATAATTAAATTCATAGGTTTTGATTTAAAATAAAATAAAAAACATTTTGAGATC
TAATAGATTAAAATATTAATTTATTAAGTTAGTTAATTAGTTGGTTACACTTAGAAATCA
TTTATTTTTTTTTGATTAAGTTAGAATTCAAGTGATAAAGCATTATTTATTTTTAATAAT
TTAATAGAAAAAGACATTAGACATTATTAAGAATTATGTTAATCAAGGCAAAGGACATTA
TAGCCCTAAGATTTTAGAAATATTTTCAGTAAAAAGAAAAGGCGAGCAAGAACGTTACTC
AAAAAATATTGGAAACGATACACTCTTATGGCATGGGTCCCGTATTTCAAACTTTGTTGG
TATATTATCTTAAGGTCTTCGTATTGCTCCTCCTGAGGCTCCTGTTACTGGTATAAATTA
ATAATTAAATAGATAAAATATCCAATATGAATTGATTTTTTTTAATTTTAGGTTATAATT
ATGGTAAGGGTATTTACCTTGCAGATTAATTTACTAAATCTTGTGATTATTGTGCAGGTA
ATAGTGATGGTATCCATTACATCATGCTCATAAAGGCTGCTCTAGGAACTCCTAACAAAA
TAGAAAAAACTGATTATAATGCTAATAATCTTCCTAAAGGAACTCATTCTTGCTGGGGTT
GGGGTACTCATGGTCCTGAAGAATTCATAACATTTAATGGAGTTAAAGTACCTAAAGGCT
AGGAAGTTAGAACTAAATCTAAGGTAAATAATTTTAAAAATTACTATTTTATTCATTTGT
TTCTATTTAATTTATTAGCACTATATGAAATATAACGAGTTTATCATTTATGATATTGCT
TAAGCTCAAATAGATTATCTAATTAGATTTAAAAAGTACTGA