Identifiers and Description

Gene Model Identifier

TTHERM_00030430

Standard Name

PARP3 (Poly [ADP-Ribose] Polymerase 3)

Aliases

PreTt14274 | 2.m02191 | 3825.m02660

Description

WGR domain containing protein; highly induced by replication stress

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00030430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18135.19.997093137033517e-262WGR domain-containing protein
(614 aa)
OxytrichaContig12012.0.g593.9982216364827585e-104Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02928201.9991716194688635e-85adprt2 on chromosome: 6 positi
on 2124835 to 2127096
WormBaseWBGene000040492.0001081030036656e-67locus:pme-1 Poly(ADP-ribose)
polymerase pme-1 status:Con
firmed UniProt:Q9N4H4 prot
ein_id:CCD73512.1
Stentor CoeruleusSteCoe_271801.4043787324419038e-54

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00030430(coding)
ATGCCACCTAAAAAAAATTAAAATAAGAGAAGCGGTAAAGATCGTTCTTTATCTCCTTAA
ACTGCTTCCGATGCAAAATAAGACCCTGTGAAAAAAGTTAAAGATGAAGTTTAAGATTTA
TAAGCTCCAGTTATTGTTAAAAGTAAATGTCCTGTTGACATGTAAGTTCCGGGTGCATCA
TCATACTAAGTATTGTAAATTGGTGACACTGTTTACAGTTTTACACTAAATTAAACTAAC
TGTGGGGCTAATAATAACAAATTTTATCTTGGATAGATACTCTATAATCCTACTGATTAA
AAATTTAGGACATTCTATAAATGGGGTAGAGTAGGAACTCCTGGCTAAAACTCTAATATA
CCATAAAATTCTTTAGAAAAGGCTATTTAAGATTATTAAAAGAAGAAAAATGATAAAATA
AAAGGTGGATATACTGAAATCTTTATAAAATATGGTGATGATGATAAAAATGATGAAGAA
GAAGAATAAAAGCAACAATAGAAACTTGAGGATAAGGAAAGAAAATAAAGTAAACTCTCT
GAGGCTGTTTAAATTATGATCAATGAAATTTTTGATTCTAAAATGATTTAAAATAGTATT
AAAGATATTGGTTTTGATTAAAAAAAGATGCCTTTAGGTAAATTAGCAGAGTAAACAATA
AAATAAGCCTATCTTGTTTTGAACGAACTTATGGAAGCCATCAAAAATAATGAAACTAGT
TAGTTTGAAAGACTTTCGAGCTCATTCTACTCATATATTCCTCATGATTTTGGCTTTTAA
AAAATGAGCCATTTTATTTTAAGATCTGAGGAATAAGTTAAGTAGAAGTTGGAAATGCTT
TAGAACTTAGAAGATCTTAAAATTGCTACTAACTTGTTAAAACTTACAGATACTGAGGAA
GCTATTATAGATGAAAATTATAAAAAACTAAAGTCTAATATTGAAGTTGTTAAAGATCAA
GATACTAGAAACATGATAATCAATTATATTAATGAGGGTTCAACTTATCGCTAACCTTAA
GTGTTAGAAATATACGAAGTAAATAGAGAAGGAGAAGATGAAAGATATACAAAAGATATA
GGAAACGATACACTTCTTTGGCATGGGTCTAGAATTTCTAACTTTGTCGGTATTCTTTCT
TAGGGACTTCGTATAGCACCTCCAGAAGCTCCAGTTTCAGGATATAACTATGGTAAGGGT
ATTTATTTAGCAGATATGTTTGATAAATCAAGATCATATTGCTAAGGAAACAGTCAAGGT
GTAAATTACATTATGCTTATTTAGGCTGCTTTAGGTAACCCGAACAGAATAGAAAGAACA
GATTACAATGCTAGTAATTTACCTTAAGGAACTAATTCCTGTTGGGGCTGGGGAACATTT
GGTCCTGAATAATTTATCACTCATAACGGTGTTAAAGTCCCTCATGGAAAGCCCGTTACG
ACCTAATCTAAGAATTATATGACTCACAATGAATTTATTATTTATAAAGTAGAATAAGCT
AAAATTAAATATTTAATTAGATTTAAATGA


>TTHERM_00030430(protein)
MPPKKNQNKRSGKDRSLSPQTASDAKQDPVKKVKDEVQDLQAPVIVKSKCPVDMQVPGAS
SYQVLQIGDTVYSFTLNQTNCGANNNKFYLGQILYNPTDQKFRTFYKWGRVGTPGQNSNI
PQNSLEKAIQDYQKKKNDKIKGGYTEIFIKYGDDDKNDEEEEQKQQQKLEDKERKQSKLS
EAVQIMINEIFDSKMIQNSIKDIGFDQKKMPLGKLAEQTIKQAYLVLNELMEAIKNNETS
QFERLSSSFYSYIPHDFGFQKMSHFILRSEEQVKQKLEMLQNLEDLKIATNLLKLTDTEE
AIIDENYKKLKSNIEVVKDQDTRNMIINYINEGSTYRQPQVLEIYEVNREGEDERYTKDI
GNDTLLWHGSRISNFVGILSQGLRIAPPEAPVSGYNYGKGIYLADMFDKSRSYCQGNSQG
VNYIMLIQAALGNPNRIERTDYNASNLPQGTNSCWGWGTFGPEQFITHNGVKVPHGKPVT
TQSKNYMTHNEFIIYKVEQAKIKYLIRFK


>TTHERM_00030430(gene)
AAAAAAATTAAAATAATCAAAAATTACATTCAACCAATAACAGAAAAAATGCCACCTAAA
AAAAATTAAAATAAGAGAAGCGGTAAAGATCGTTCTTTATCTCCTTAAACTGCTTCCGAT
GCAAAATAAGACCCTGTGAAAAAAGTTAAAGATGAAGTTTAAGATTTATAAGCTCCAGTT
ATTGTTAAAAGTAATCGTTATTAAAATTGATGTAGGAATTAGCAAAACATATTTTATTTT
TTTAGGTAAATGTCCTGTTGACATGTAAGTTCCGGGTGCATCATCATACTAAGTATTGTA
AATTGGTGACACTGTTTACAGTTTTACACTAAATTAAACTAACTGTGGGGCTAATAATAA
CAAATTTTATCTTGGATAGATACTCTATAATCCTACTGATTGTAAATTATTAAATAAATG
TATGATTTATAGCTAAAAATATTTAAAGAAAAATTTAGGACATTCTATAAATGGGGTAGA
GTAGGAACTCCTGGCTAAAACTCTAATATACCATAAAATTCTTTAGAAAAGGCTATTTAA
GATTATTAAAAGAAGAAAAATGATAAAATAAAAGGTGGATATACTGAAATCTTTATAAAA
TATGGTGATGATGATAAAAATGATGAAGAAGAAGAATAAAAGCAACAATAGAGTAAATAT
TTATAACTTTTTGTGATTGTTTTTGACACACAACAAATACAAGCTATTAACATTTAGCAT
TAATTCCATCTTACTAATTCATTATTTACTTACTTATTTCTTTACTAAATAGAACTTGAG
GATAAGGAAAGAAAATAAAGTAAACTCTCTGAGGCTGTTTAAATTATGATCAATGAAATT
TTTGATTCTAAAATGATTTAAAATAGTATTAAAGATATTGGTTTTGATTAAAAAAAGATG
CCTTTAGGTAAATTAGCAGAGTAAACAATAAAATAAGCCTATCTTGTTTTGAACGAAGTA
TAAAAAGCTTAAAGATATTACTTTTTCATTTATTTTTTCATTTAAAAAGCTTATGGAAGC
CATCAAAAATAATGAAACTAGTTAGTTTGAAAGACTTTCGAGCTCATTCTACTCATATAT
TCCTCATGATTTTGGCTTTTAAAAAATGAGCCATTTTATTTTAAGATCTGAGGAATAAGT
TAAGTAGAAGTTGGAAATGCTTTAGAACTTAGAAGATCTTAAAATTGCTACTAACTTGTT
AAAACTTACAGATACTGAGGAAGCTATTATAGATGAAAATTATAAAAAACTAAAGTCTAA
TATTGAAGTTGTTAAAGATGTAAACTTAATTAAATAAACTTTATGTATCATTTTAATTTT
TTGATTTAATTAGCAAGATACTAGAAACATGATAATCAATTATATTAATGAGGGTTCAAC
TTATCGCTAACCTTAAGTGTTAGAAATATACGAAGTAAATAGAGAAGGAGAAGATGAAAG
ATATACAAAAGATATAGGAAACGATACACTTCTTTGGCATGGGTCTAGAATTTCTAACTT
TGTCGGTATTCTTTCTTAGGGACTTCGTATAGCACCTCCAGAAGCTCCAGTTTCAGGTAA
GAATAAGTTTATTTTAAAATTATATTTATATTGATAAATAAACAAATAAAAGGATATAAC
TATGGTAAGGGTATTTATTTAGCAGATATGTTTGATAAATCAAGATCATATTGCTAAGGA
AACAGTCAAGGTGTAAATTACATTATGCTTATTTAGGCTGCTTTAGGTAACCCGAACAGA
ATAGAAAGAACAGATTACAATGCTAGTAATTTACCTTAAGGAACTAATTCCTGTTGGGGC
TGGGGAACATTTGGTCCTGAATAATTTATCACTCATAACGGTGTTAAAGTCCCTCATGGA
AAGCCCGTTACGACCTAATCTAAGGTAAAATTAATTATAAATATCTTAAAACCTTTTAAA
ATGTTTATTTTTTAAAAAAAACCAAGAATTATATGACTCACAATGAATTTATTATTTATA
AAGTAGAATAAGCTAAAATTAAATATTTAATTAGATTTAAATGA