Identifiers and Description

Gene Model Identifier

TTHERM_00030430

Standard Name

PARP3 (poly [ADP-ribose] polymerase 3)

Aliases

PreTt14274 | 2.m02191 | 3825.m02660

Description

WGR domain containing protein. Highly induced by replication stress.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00030430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18135.19.997093137033517e-262WGR domain-containing protein
(614 aa)
OxytrichaContig12012.0.g593.9982216364827585e-104Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02928201.9991716194688635e-85adprt2 on chromosome: 6 positi
on 2124835 to 2127096
WormBaseWBGene000040492.0001081030036656e-67locus:pme-1 Poly(ADP-ribose)
polymerase pme-1 status:Con
firmed UniProt:Q9N4H4 prot
ein_id:CCD73512.1
Stentor CoeruleusSteCoe_271801.4043787324419038e-54

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00030430(coding)
ATGCCACCTAAAAAAAATTAAAATAAGAGAAGCGGTAAAGATCGTTCTTTATCTCCTTAA
ACTGCTTCCGATGCAAAATAAGACCCTGTGAAAAAAGTTAAAGATGAAGTTTAAGATTTA
TAAGCTCCAGTTATTGTTAAAAGTAAATGTCCTGTTGACATGTAAGTTCCGGGTGCATCA
TCATACTAAGTATTGTAAATTGGTGACACTGTTTACAGTTTTACACTAAATTAAACTAAC
TGTGGGGCTAATAATAACAAATTTTATCTTGGATAGATACTCTATAATCCTACTGATTAA
AAATTTAGGACATTCTATAAATGGGGTAGAGTAGGAACTCCTGGCTAAAACTCTAATATA
CCATAAAATTCTTTAGAAAAGGCTATTTAAGATTATTAAAAGAAGAAAAATGATAAAATA
AAAGGTGGATATACTGAAATCTTTATAAAATATGGTGATGATGATAAAAATGATGAAGAA
GAAGAATAAAAGCAACAATAGAAACTTGAGGATAAGGAAAGAAAATAAAGTAAACTCTCT
GAGGCTGTTTAAATTATGATCAATGAAATTTTTGATTCTAAAATGATTTAAAATAGTATT
AAAGATATTGGTTTTGATTAAAAAAAGATGCCTTTAGGTAAATTAGCAGAGTAAACAATA
AAATAAGCCTATCTTGTTTTGAACGAACTTATGGAAGCCATCAAAAATAATGAAACTAGT
TAGTTTGAAAGACTTTCGAGCTCATTCTACTCATATATTCCTCATGATTTTGGCTTTTAA
AAAATGAGCCATTTTATTTTAAGATCTGAGGAATAAGTTAAGTAGAAGTTGGAAATGCTT
TAGAACTTAGAAGATCTTAAAATTGCTACTAACTTGTTAAAACTTACAGATACTGAGGAA
GCTATTATAGATGAAAATTATAAAAAACTAAAGTCTAATATTGAAGTTGTTAAAGATCAA
GATACTAGAAACATGATAATCAATTATATTAATGAGGGTTCAACTTATCGCTAACCTTAA
GTGTTAGAAATATACGAAGTAAATAGAGAAGGAGAAGATGAAAGATATACAAAAGATATA
GGAAACGATACACTTCTTTGGCATGGGTCTAGAATTTCTAACTTTGTCGGTATTCTTTCT
TAGGGACTTCGTATAGCACCTCCAGAAGCTCCAGTTTCAGGATATAACTATGGTAAGGGT
ATTTATTTAGCAGATATGTTTGATAAATCAAGATCATATTGCTAAGGAAACAGTCAAGGT
GTAAATTACATTATGCTTATTTAGGCTGCTTTAGGTAACCCGAACAGAATAGAAAGAACA
GATTACAATGCTAGTAATTTACCTTAAGGAACTAATTCCTGTTGGGGCTGGGGAACATTT
GGTCCTGAATAATTTATCACTCATAACGGTGTTAAAGTCCCTCATGGAAAGCCCGTTACG
ACCTAATCTAAGAATTATATGACTCACAATGAATTTATTATTTATAAAGTAGAATAAGCT
AAAATTAAATATTTAATTAGATTTAAATGA


>TTHERM_00030430(protein)
MPPKKNQNKRSGKDRSLSPQTASDAKQDPVKKVKDEVQDLQAPVIVKSKCPVDMQVPGAS
SYQVLQIGDTVYSFTLNQTNCGANNNKFYLGQILYNPTDQKFRTFYKWGRVGTPGQNSNI
PQNSLEKAIQDYQKKKNDKIKGGYTEIFIKYGDDDKNDEEEEQKQQQKLEDKERKQSKLS
EAVQIMINEIFDSKMIQNSIKDIGFDQKKMPLGKLAEQTIKQAYLVLNELMEAIKNNETS
QFERLSSSFYSYIPHDFGFQKMSHFILRSEEQVKQKLEMLQNLEDLKIATNLLKLTDTEE
AIIDENYKKLKSNIEVVKDQDTRNMIINYINEGSTYRQPQVLEIYEVNREGEDERYTKDI
GNDTLLWHGSRISNFVGILSQGLRIAPPEAPVSGYNYGKGIYLADMFDKSRSYCQGNSQG
VNYIMLIQAALGNPNRIERTDYNASNLPQGTNSCWGWGTFGPEQFITHNGVKVPHGKPVT
TQSKNYMTHNEFIIYKVEQAKIKYLIRFK


>TTHERM_00030430(gene)
AAAAAAATTAAAATAATCAAAAATTACATTCAACCAATAACAGAAAAAATGCCACCTAAA
AAAAATTAAAATAAGAGAAGCGGTAAAGATCGTTCTTTATCTCCTTAAACTGCTTCCGAT
GCAAAATAAGACCCTGTGAAAAAAGTTAAAGATGAAGTTTAAGATTTATAAGCTCCAGTT
ATTGTTAAAAGTAATCGTTATTAAAATTGATGTAGGAATTAGCAAAACATATTTTATTTT
TTTAGGTAAATGTCCTGTTGACATGTAAGTTCCGGGTGCATCATCATACTAAGTATTGTA
AATTGGTGACACTGTTTACAGTTTTACACTAAATTAAACTAACTGTGGGGCTAATAATAA
CAAATTTTATCTTGGATAGATACTCTATAATCCTACTGATTGTAAATTATTAAATAAATG
TATGATTTATAGCTAAAAATATTTAAAGAAAAATTTAGGACATTCTATAAATGGGGTAGA
GTAGGAACTCCTGGCTAAAACTCTAATATACCATAAAATTCTTTAGAAAAGGCTATTTAA
GATTATTAAAAGAAGAAAAATGATAAAATAAAAGGTGGATATACTGAAATCTTTATAAAA
TATGGTGATGATGATAAAAATGATGAAGAAGAAGAATAAAAGCAACAATAGAGTAAATAT
TTATAACTTTTTGTGATTGTTTTTGACACACAACAAATACAAGCTATTAACATTTAGCAT
TAATTCCATCTTACTAATTCATTATTTACTTACTTATTTCTTTACTAAATAGAACTTGAG
GATAAGGAAAGAAAATAAAGTAAACTCTCTGAGGCTGTTTAAATTATGATCAATGAAATT
TTTGATTCTAAAATGATTTAAAATAGTATTAAAGATATTGGTTTTGATTAAAAAAAGATG
CCTTTAGGTAAATTAGCAGAGTAAACAATAAAATAAGCCTATCTTGTTTTGAACGAAGTA
TAAAAAGCTTAAAGATATTACTTTTTCATTTATTTTTTCATTTAAAAAGCTTATGGAAGC
CATCAAAAATAATGAAACTAGTTAGTTTGAAAGACTTTCGAGCTCATTCTACTCATATAT
TCCTCATGATTTTGGCTTTTAAAAAATGAGCCATTTTATTTTAAGATCTGAGGAATAAGT
TAAGTAGAAGTTGGAAATGCTTTAGAACTTAGAAGATCTTAAAATTGCTACTAACTTGTT
AAAACTTACAGATACTGAGGAAGCTATTATAGATGAAAATTATAAAAAACTAAAGTCTAA
TATTGAAGTTGTTAAAGATGTAAACTTAATTAAATAAACTTTATGTATCATTTTAATTTT
TTGATTTAATTAGCAAGATACTAGAAACATGATAATCAATTATATTAATGAGGGTTCAAC
TTATCGCTAACCTTAAGTGTTAGAAATATACGAAGTAAATAGAGAAGGAGAAGATGAAAG
ATATACAAAAGATATAGGAAACGATACACTTCTTTGGCATGGGTCTAGAATTTCTAACTT
TGTCGGTATTCTTTCTTAGGGACTTCGTATAGCACCTCCAGAAGCTCCAGTTTCAGGTAA
GAATAAGTTTATTTTAAAATTATATTTATATTGATAAATAAACAAATAAAAGGATATAAC
TATGGTAAGGGTATTTATTTAGCAGATATGTTTGATAAATCAAGATCATATTGCTAAGGA
AACAGTCAAGGTGTAAATTACATTATGCTTATTTAGGCTGCTTTAGGTAACCCGAACAGA
ATAGAAAGAACAGATTACAATGCTAGTAATTTACCTTAAGGAACTAATTCCTGTTGGGGC
TGGGGAACATTTGGTCCTGAATAATTTATCACTCATAACGGTGTTAAAGTCCCTCATGGA
AAGCCCGTTACGACCTAATCTAAGGTAAAATTAATTATAAATATCTTAAAACCTTTTAAA
ATGTTTATTTTTTAAAAAAAACCAAGAATTATATGACTCACAATGAATTTATTATTTATA
AAGTAGAATAAGCTAAAATTAAATATTTAATTAGATTTAAATGA