Identifiers and Description

Gene Model Identifier

TTHERM_00467770

Standard Name

PARP12 (Poly(ADP-Ribose) Polymerase 12)

Aliases

PreTt18679 | 55.m00234 | 3710.m00083

Description

poly polymerase and DNA-ligase Zn-finger region family protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02037 ) SAP domain
  • ( PF06839 ) GRF zinc finger
  • ( PF08063 ) PADR1 (NUC008) domain
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00467770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15716.11.0003279799459891e-139hypothetical protein (286 aa)
Stentor CoeruleusSteCoe_105420.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00467770(coding)
ATGAATTTTTATGATTATGATAGCAATACACCAGAATATAAATTCTACGAAGATTTATAT
CTCGAAGTTTCTGTTTCAAATAAAGCCAAGTGCAGATCTTGTGGCAAAACTATTGATAAA
GATGTGCTCAGATGGTGTAGCTCAGAAAGAGATAGAGCTGAACCTATTTATGTAAGTAAA
AGATATTATCACCAAAAGTGTTTACCTCCTGTAGCTGGTCATCCTATCGTTGATTATAAC
CCTAAAACATAAACAGGAAAGCTTAAAAACATGAATGTAAATCCATCTAAGTAAACAGAA
AAGGATTTATTTAACAATGCTGTGGATGAATATGTTAAATACAGAAACAACTATGATAAA
AAAAGTAAAAAATAAGATAAAAACTGGGATCCAGATAACTCAGATTCTGATTCAGGAGAA
GAGGTAGTTAAAAAAGCAAAGAAAGCTACAAAAGTGAATAAGTCTGAAAAGAAAACCAAC
AAGAGATCAAAAGCTGATGATAGCGATGAAGATATAGATGCTGAAGTTAGCTTGGCTGGA
TACACAGATGGTTAAAGATAAAAATACTTAAAAAAATTAGAAGAACTAAAATCTAAAACT
GTTGCTTAACTCAAAGCTATTTTAAAAGCAAATAATTAAACATAAACAGGTACTAAAGAA
GTACTTTTAGAAAAAGTAGCAGATGGATACACCCTTGGTGCTATACCACAATGCACTAAA
TGTGGAGGGGGTAAACTAAGATTCAACAAATCTACAGGAGAGTATACTTGTCCTGGATTT
ATGGAAGATACTGATAAAGTTGATTGTGATGCTGTATTCTCAATAGATTAAGTTGTTAGA
TTTGATTGGGTAGAACCATGA


>TTHERM_00467770(protein)
MNFYDYDSNTPEYKFYEDLYLEVSVSNKAKCRSCGKTIDKDVLRWCSSERDRAEPIYVSK
RYYHQKCLPPVAGHPIVDYNPKTQTGKLKNMNVNPSKQTEKDLFNNAVDEYVKYRNNYDK
KSKKQDKNWDPDNSDSDSGEEVVKKAKKATKVNKSEKKTNKRSKADDSDEDIDAEVSLAG
YTDGQRQKYLKKLEELKSKTVAQLKAILKANNQTQTGTKEVLLEKVADGYTLGAIPQCTK
CGGGKLRFNKSTGEYTCPGFMEDTDKVDCDAVFSIDQVVRFDWVEP


>TTHERM_00467770(gene)
ATGAATTTTTATGATTATGATAGCAATACACCAGAATATAAATTCTACGAAGATTTATAT
CTCGAAGTTTCTGTTTCAAATAAAGCCAAGTGCAGATCTTGTGGCAAAACTATTGATAAA
GATGTGCTCAGATGGTGTAGCTCAGAAAGAGATAGAGCTGAACCTATTTATGTAAGTAAA
AGATATTATCACCAAAAGTGTTTACCTCCTGTAGCTGGTCATCCTATCGTTGATTATAAC
CCTAAAACATAAACAGGAAAGCTTAAAAACATGAATGTAAATCCATCTAAGTAAACAGAA
AAGGATTTATTTAACAATGCTGTGGATGAATATGTTAAATACAGAAACAACTATGATAAA
AAAAGTAAAAAATAAGATAAAAACTGGGATCCAGATAACTCAGATTCTGATTCAGGAGAA
GAGGTAGTTAAAAAAGCAAAGAAAGCTACAAAAGTGAATAAGTCTGAAAAGAAAACCAAC
AAGAGATCAAAAGCTGATGATAGCGATGAAGATATAGATGCTGAAGTTAGCTTGGCTGGA
TACACAGATGGTTAAAGATAAAAATACTTAAAAAAATTAGAAGAACTAAAATCTAAAACT
GTTGCTTAACTCAAAGCTATTTTAAAAGCAAATAATTAAACATAAACAGGTACTAAAGAA
GTACTTTTAGAAAAAGTAGCAGATGGATACACCCTTGGTGCTATACCACAATGCACTAAA
TGTGGAGGGGGTAAACTAAGATTCAACAAATCTACAGGAGAGTATACTTGTCCTGGATTT
ATGGAAGATACTGATAAAGTTGATTGTGATGCTGTATTCTCAATAGATTAAGTTGTTAGA
TTTGATTGGGTAGAACCATGA