Identifiers and Description

Gene Model Identifier

TTHERM_00821920

Standard Name

PARP10 (Poly(ADP-Ribosyl) transferase 10)

Aliases

PreTt07751 | 140.m00066 | 3759.m00368

Description

poly (ADP-ribose) polymerase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00821920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_101590
Tetrahymena borealisEI9_17509.19.997093137033517e-262hypothetical protein (978 aa)
OxytrichaContig604.0.g136.997498932278805e-30Poly(ADP-ribose) polymerase ca
talytic domain
DictyBaseDDB_G02717663.000555717977434e-27pARTg on chromosome: 2 positio
n 860066 to 865156

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00821920(coding)
ATGAAGAGAAAGAGTGATATGGTAAACGAACTTTCAGATGACGAAGAGAGAATTTGTTAG
TTAGTTGCTGAGTATGAAAGATAGGAATAATAATCTTAAAAAAAACCATTAAAAGGTTAA
TTTTATTTGTAAAAAATGATGAAAAAAAATGATAACAGCGAAGGCTAAAGAAAAATAAAT
GAAATGCCTCCAGTTTAAAATCAAATGATAATGAGAGGAGCTAGCATGAATCATAAGCGT
TTTTAAATTATTGAGTTTCAAGATGCTCTAGTTTTGAAGATTTTGATCAATCAGAATTCC
GAAATGCTTAGAAAATTTTGTTCATAAAAAAATATGAATTTCAGAATCCGCCGAGACAAG
AAACCAGCCTATATTGAAGTTTTTGGGAACAATTAATAAGATATGGATGAAAGAGACTTA
GAAGAGTTCACAAATTTAGTAATGAGCTGCAAAGTTAGTATACGAAGTGAAATAAAGGAA
ATAGAATTAAAGTGTAACTCTGATGAGTATGCTTATATAAACAAAAAATTAGATGATTAC
ATAGAATAGCTTAATTATACTGAAGTTAAATTTTTAGATCCTGAAGGCAATTAGGATGAA
ATAAATCCTGAAATAGTATATAATCCTGACTTAATAAGATCTTATTTAATCAATTAAAAA
TTTATATTGAAGCTGTCCAAGATTGAGAAGCCTTAATTATTAGGCTTTCATAATATAGAT
TTATTCTTAGTCAATATTGAATCTGATGGAATTTACACTGATCCTTTTGGATACGAATTG
ATTAACAAAAATAAATCAATCAAAGATTTAATCAAAAAAAACAAGGATAAACTCTCTTAG
GAAGATATTATCTATGATCAAATTTTTAAATATGACAACAAGGAAGTCAACTTAATCATT
TAGACATCAAAATCTCAAGAAAAATGCATTGAAAATTTAAAGAATCTTTTTTAAAAAATT
GATAAACAAGAACTGTATAACAAAGGCTTTTTAAATATTTGCATCAGTTTGAACTTAAAT
TGTGGAAAGAAGTACATGCAAGAAATTCTTAAATATCTCAATAAAGTTTCTGATGAAGAC
ACCTATCTTTCATTTCCAAGTGAGATTAATTTGTTTATGTCTGAGGAAAGAGAATCAACG
ATATCTTCTTACTTAAGTGATGTCATCAAAAACAAGAATATTAACCCTGATAAAGTAAAA
AAAGGAGGTTAATGGTCTTATGCAATTTGTTATTATGGATAAAATAGAAATTAAAATTAC
TTTTTTAACTTTAATGCTAATTTATACCAAAATACACCTACTACTAATTTTAAAGAAAAT
CCTTCTATCGCCATTGAAAGAGCTTTTCTCAGAGATGAGAAAAAAGTTTATATTGCTACT
GAACAACTAGCTTAAAATCCTAATTAAAACCTATTTGGTGGTTATTACAAGAAAGGAAAA
AAAATCAACAAAAATAACGAAGTTGAAGAAGATATGGTTGAAGATGTTGAAGTAAATTTT
GAAAATATGACAGAAACTTTTCTTTCTAGTAAACTTGAGAGACCCATATCACAGGATCCT
AAAAGAAAGCAAAAGTGGTAATACATAGACACTATCACTTAGGAATTTGCAGATTTCGAA
GATGAATTATGCAAGGTTTTCAAGTCATGTTAAGAAAATGGTCAAAAAACATTCATTTAC
CAGAGGAATATTATGGATTTTAATCTTTCCTCTCATATAATGAAATGTGACATTAGTAAG
AGCATGATGACTGATTTGAAAACAGGTGATGTTTTTTTCATAAAGAGAGAAGAGAACTCC
AAGTTTAATTATCTAGTTGAAGAAGCAGATCCTTCTGCACAATCAGAGCGTATTGACGTA
CAAGAATAAAAAAAATAAGTGAACAAAAAAGATAGAGCTAAAGAAAAATAAGAATAATAA
GAATTAGAAGAAAAGAAAAAGCTTGGTCCCTAACTGAAAATAAGGGGACTAAAAGATGGT
ATAGAAATCGTCAAAAACATTTGTGAAAAAATGAAAAAAGATAAAAGATCAGTTCATATC
ATTAAATTAGAAAGGAAAATACCTAAAAATAACATAAAATTTTTAGAGGAAATATCTTTG
TAAAATAATATTGAGATGGAGTATGACGAGAAGAGGGAAGAGTTAATTTTGAAAGGCTAC
AAAAAGACTATAAACAGACTTAGAAACTAATTTATAAAAGGTTTAAGCATTAAGTTTGAT
GATTTTACAGTACCTGATGACTGGGAATCTCAAGATTAAGATGTGGAAGTTTTTGATGTG
AAACTTGATAGTGATTATGCAAAAAATATAATGAAAATAGTCAAAAAATCTATACCAAAT
GCCAAGTTTCATAAGTTAGAAAGAATCTAAAACTTAAAGTTATGGAAGAATTTCTGTTTT
GAGAGAAAAAAGCTTGAAGAAAAAGGTGATGCTACAGAAAAGTGGCTATTCCATGGAACC
AGAAATACTGATCCTTCAGTTATATACAAAGGCAGTGAAGAAGGTTTCGATTTTAGAGTG
TGCTCAGGAGGTATGTATGGCAGAGGTACATACTTCCATGATATGGCAAGTTATTCTTAT
GGTTTTGGTCATAACAAAGGAGGAAAAATATAACTCTTCTGTGCAAAGGTTTTGATCGGA
AAATGCTACGCAACAGGACCTAATGGAAATTTGACCGCTCCTCCATTTATTGCTGGATCG
AAAAGTATTCGTTATGATTCCATCCGCTCAAATAATGCAATAGGATAAAATGAATATGTT
ATCTTCAACAATAGCAAAGCATACCCTTATTATTTAATAACAATGACTAACTAAGGAGGT
GTAGGAAACAATCTAATGTTTAACAATATCAATAACGCCAATTACTATAGTGAAGAAGAC
GAAGAAGAAGACCCTGATTTCTATGATGAAGAAGAAGAGGATTATTGA


>TTHERM_00821920(protein)
MKRKSDMVNELSDDEERICQLVAEYERQEQQSQKKPLKGQFYLQKMMKKNDNSEGQRKIN
EMPPVQNQMIMRGASMNHKRFQIIEFQDALVLKILINQNSEMLRKFCSQKNMNFRIRRDK
KPAYIEVFGNNQQDMDERDLEEFTNLVMSCKVSIRSEIKEIELKCNSDEYAYINKKLDDY
IEQLNYTEVKFLDPEGNQDEINPEIVYNPDLIRSYLINQKFILKLSKIEKPQLLGFHNID
LFLVNIESDGIYTDPFGYELINKNKSIKDLIKKNKDKLSQEDIIYDQIFKYDNKEVNLII
QTSKSQEKCIENLKNLFQKIDKQELYNKGFLNICISLNLNCGKKYMQEILKYLNKVSDED
TYLSFPSEINLFMSEERESTISSYLSDVIKNKNINPDKVKKGGQWSYAICYYGQNRNQNY
FFNFNANLYQNTPTTNFKENPSIAIERAFLRDEKKVYIATEQLAQNPNQNLFGGYYKKGK
KINKNNEVEEDMVEDVEVNFENMTETFLSSKLERPISQDPKRKQKWQYIDTITQEFADFE
DELCKVFKSCQENGQKTFIYQRNIMDFNLSSHIMKCDISKSMMTDLKTGDVFFIKREENS
KFNYLVEEADPSAQSERIDVQEQKKQVNKKDRAKEKQEQQELEEKKKLGPQLKIRGLKDG
IEIVKNICEKMKKDKRSVHIIKLERKIPKNNIKFLEEISLQNNIEMEYDEKREELILKGY
KKTINRLRNQFIKGLSIKFDDFTVPDDWESQDQDVEVFDVKLDSDYAKNIMKIVKKSIPN
AKFHKLERIQNLKLWKNFCFERKKLEEKGDATEKWLFHGTRNTDPSVIYKGSEEGFDFRV
CSGGMYGRGTYFHDMASYSYGFGHNKGGKIQLFCAKVLIGKCYATGPNGNLTAPPFIAGS
KSIRYDSIRSNNAIGQNEYVIFNNSKAYPYYLITMTNQGGVGNNLMFNNINNANYYSEED
EEEDPDFYDEEEEDY


>TTHERM_00821920(gene)
ATGAAGAGAAAGAGTGATATGGTAAACGAACTTTCAGATGACGAAGAGAGAATTTGTTAG
TTAGTTGCTGAGTATGAAAGATAGGAATAATAATCTTAAAAAAAACCATTAAAAGGTTAA
TTTTATTTGTAAAAAATGATGAAAAAAAATGATAACAGCGAAGGCTAAAGAAAAATAAAT
GAAATGCCTCCAGTTTAAAATCAAATGATAATGAGAGGAGCTAGCATGAATCATAAGCGT
TTTTAAATTATTGAGTTTCAAGATGCTCTAGTTTTGAAGATTTTGATCAATCAGAATTCC
GAAATGCTTAGAAAATTTTGTTCATAAAAAAATATGAATTTCAGAATCCGCCGAGACAAG
AAAGTAATTTTTAACTTAGCAATTCATTCAAACTTAATTCATTTTGATATGTGAAATAAA
AACTTATAATTGTTTTATATCATAAAAAGCCAGCCTATATTGAAGTTTTTGGGAACAATT
AATAAGATATGGATGAAAGAGACTTAGAAGAGTTCACAAATTTAGTAATGAGCTGCAAAG
TTAGTATACGAAGTGAAATAAAGGAAATAGAATTAAAGTGTAACTCTGATGAGTATGCTT
ATATAAACAAAAAATTAGATGATTACATAGAATAGCTTAATTATACTGAAGTTAAATTTT
TAGATCCTGAAGGCAATTAGGATGAAATAAATCCTGAAATAGTATATAATCCTGACTTAA
TAAGATCTTATTTAGTAAAGTTTTATAGTATTTATTTCTGCAAATATCTAAATATTTTTT
ATTATTCAAATACTTAGATCAATTAAAAATTTATATTGAAGCTGTCCAAGATTGAGAAGC
CTTAATTATTAGGCTTTCATAATATAGATTTATTCTTAGTCAATATTGAATCTGATGGAA
TTTACACTGATCCTTTTGGATACGAATTGATTAACAAAAATAAATCAATCAAAGATTTAA
TCAAAAAAAACAAGGATAAACTCTCTTAGGAAGATATTATCTATGATCAAATTTTTAAAT
ATGACAACAAGGTATATATTATTTAGTTATTTATTTTATTATTTTATCAATCCAAATTAT
TTTGAATTTGCTTGTTGTTAACTAAATATTTTATTTTTTTAATTTTTAGGAAGTCAACTT
AATCATTTAGACATCAAAATCTCAAGAAAAATGCATTGAAAATTTAAAGAATCTTTTTTA
AAAAATTGATAAACAAGAACTGTATAACAAAGGCTTTTTAAATATTTGCATCAGTTTGAA
CTTAAATTGTGGAAAGAAGTACATGCAAGAAATTCTTAAATATCTCAATAAAGTTTCTGA
TGAAGACACCTATCTTTCATTTCCAAGTGAGATTAATTTGTTTATGTCTGAGGAAAGAGA
ATCAACGATATCTTCTTACTTAAGTGATGTCATCAAAAACAAGAATATTAACCCTGATAA
AGTAAAAAAAGGAGGTTAATGGTCTTATGCAATTTGTTATTATGGATAAAATAGAAATTA
AAATTACTTTTTTAACTTTAATGCTAATTTATACCAAAATACACCTACTACTAATTTTAA
AGAAAATCCTTCTATCGCCATTGAAAGAGCTTTTCTCAGAGATGAGAAAAAAGTTTATAT
TGCTACTGAACAACTAGCTTAAAATGTAAATAAATACTTTTAACTAACATCTTTTTAAAA
TGTTAATATTTCCAAAATATTTTAAAAAATAGCCTAATTAAAACCTATTTGGTGGTTATT
ACAAGAAAGGAAAAAAAATCAACAAAAATAACGAAGTTGAAGAAGATATGGTTGAAGATG
TTGAAGTAAATTTTGAAAATATGACAGAAACTTTTCTTTCTAGTAAACTTGAGAGACCCA
TATCACAGGATCCTAAAAGAAAGCAAAAGTGGTAATACATAGACACTATCACTTAGGAAT
TTGCAGATTTCGAAGATGAATTATGCAAGGTTTTCAAGTCATGTTAAGAAAATGGTCAAA
AAACATTCATTTACCAGAGGAATATTATGGATTTTAATCTTTCCTCTCATATAATGAAAT
GTGACATTAGTAAGAGCATGATGACTGATTTGAAAACAGGTACTTATTTTTTTATAGTTT
TTATTTTTTTACAGAAAATTTAGTTTAGATTTTAGTCATAAAATGTTTGCTAAATCTTAA
ATTTGTAGAATTTTTTTTTAAATTAAATTAGGAGTTAATTTTATTTTTTAAATTTTACAA
GCAAAATGTTAATTTAATAAATCTAATTTAAAAAATATGTAAATTTAAAGGTGATGTTTT
TTTCATAAAGAGAGAAGAGAACTCCAAGTTTAATTATCTAGTTGAAGAAGCAGATCCTTC
TGCACAATCAGAGCGTATTGACGTACAAGAATAAAAAAAATAAGTGAACAAAAAAGATAG
AGCTAAAGAAAAATAAGAATAATAAGAATTAGAAGAAAAGAAAAAGCTTGGTCCCTAACT
GAAAATAAGGGGACTAAAAGATGGTATAGAAATCGTCAAAAACATTTGTGAAAAAATGAA
AAAAGATAAAAGATCAGTTCATATCATTAAATTAGAAAGGAAAATACCTAAAAATAACAT
AAAATTTTTAGAGGAAATATCTTTGTAAAATAATATTGAGATGGAGTATGACGAGAAGAG
GGAAGAGTTAATTTTGAAAGGCTACAAAAAGACTATAAACAGACTTAGAAACTAATTTAT
AAAAGGTAAAAAATTGCTTTTAATTTTTCTGGATTTCACATATTTTATATATAATCTTTT
TAGGTTTAAGCATTAAGTTTGATGATTTTACAGTACCTGATGACTGGGAATCTCAAGATT
AAGATGTGGAAGTTTTTGATGTGAAACTTGATAGTGATTATGCAAAAAATATAATGAAAA
TAGTCAAAAAATCTATACCAAATGCCAAGTTTCATAAGTTAGAAAGAATCTAAAACTTAA
AGTTATGGAAGAATTTCTGTTTTGAGAGAAAAAAGCTTGAAGAAAAAGGTGATGCTACAG
AAAAGTGGCTATTCCATGGAACCAGAAATACTGATCCTTCAGTTATATACAAAGGTACTT
CATTAAATTATATAAATACTTATAAAATATACTCATCTGTAAAAATTAGGCAGTGAAGAA
GGTTTCGATTTTAGAGTGTGCTCAGGAGGTATGTATGGCAGAGGTACATACTTCCATGAT
ATGGCAAGTTATTCTTATGGTTTTGGTCATAACAAAGGAGGAAAAATATAACTCTTCTGT
GCAAAGGTTTTGATCGGAAAATGCTACGCAACAGGACCTAATGGAAATTTGACCGCTCCT
CCATTTATTGCTGGATCGAAAAGTATTCGTTATGATTCCATCCGCTCAAATAATGCAATA
GGATAAAATGAATATGTTATCTTCAACAATAGCAAAGCATACCCTTATTATTTAATAACA
ATGACTAACTAAGGAGGTGTAGGAAACAATCTAATGTTTAACAATATCAATAACGCCAAT
TACTATAGTGAAGAAGACGAAGAAGAAGACCCTGATTTCTATGATGAAGAAGAAGAGGAT
TATTGA