Identifiers and Description

Gene Model Identifier

TTHERM_00294690

Standard Name

PARG1 (Poly(ADP-Ribose) Glycohydrolase 1)

Aliases

PreTt15579 | 27.m00239 | 3692.m00042

Description

poly(ADP-ribose) glycohydrolase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01741 ) conserved hypothetical protein
  • ( PF05028 ) Poly (ADP-ribose) glycohydrolase (PARG)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00294690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08724.19.997093137033517e-262poly (ADP-ribose) glycohydrola
se (PARG) (459 aa)
DictyBaseDDB_G02779431.9993430003514377e-39parG on chromosome: 3 position
42510 to 44486
OxytrichaContig14723.0.g466.0018235484001396e-36Poly (ADP-ribose) glycohydrola
se (PARG)
WormBaseWBGene000040529.99893167504554e-35locus:pme-4 Poly(ADP-ribose)
glycohydrolase pme-4 status
:Confirmed UniProt:Q9N5L4
protein_id:CCD68980.1
Stentor CoeruleusSteCoe_189763.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00294690(coding)
ATGATCGAAGCGGAAAAATAAGAAAATAAAAAAATCTAAGATTATTAATTTCCATTACCA
TAAAAAAATAGTGAACTTTGGATAATTTAAAAAAAAACTCTCTAAGATTTAAGCTCAGGA
AAATAAAAACTAGATAGCTTTTAATCTCTAGAGTCTATTTTAGAAATATTGAGAGACAGT
AAAAACTAAAACGATGAGAAGTATTTTAACCTAAAAGCTGTATTTGAATAGCTTGATAAA
GAAGAGCAAACATATTTCTTGGAATAGTTCATTCCTAAAATATGCTAGCTTGTTCTAAAA
ATTAAAAAGAAGTAATTAAAAAATTAGATTCCAAAAGAATCTAAGATTTATGAAGCTGCT
TTCTCTAGAGAAGAAATATCTTACTATGTTAGCTGTATGTTTTTATGTATACTCAAAGAC
TAAGACAGAAAAATATATAAAGATTTTAGATTAATATACCTCAAAGACCTAGTGTAATAA
ATTAACATACGCAGATAAGAAAAAATAAAATGCTTTTATGAATACTTGAAGCAAGCTTTA
GACTTTTCGGAAAAAGAATCTAAAGAGGTGGTTATCTTCTAAAGAATTAATTGTGGTCAA
TTAGAAGATTATGAAAATTGGGTTGACAAATTAAAGGCTATTAAGTTAAAAAATGTTTAA
CTAACAGATGATAAGCTAATCGAAGACTTTCCAGGTACCCTTCAAGTAGATTTTGCAAAT
TGTGATATAGGGGGAGGTATTTTAGGTAATGGATTGGTTTAAGAAGAAATAAGATTTTGT
GTATGTCCTGAAATGTTAGTAAGCTTGCTAGTTTTTGATTAATCTATGGAAGCAAATGAA
GTAATTATAATGAAAGGAATTAAATAGTATTCTGATTATTAAGGTTATAGTAATTCATTT
AGATTCGTTAAAATGGGAAATTCTAAGATTTAAAAGTAGAAAAGAAACAACCCTTAAACG
ATATTAGCTATAGATGCACTATGTTTCAATAGCTCTGACAATTAATTTTCTGAAGTAAAT
GTTAGCAGAGAGCTTAATAAATCGTATATGGGATTTAAATAAGAAGATTAATTAAAAACA
ATTTCAACTGGTAAATGGGGATGTGGTGCATTTCTAGGTGTATTTGATTTAAAATTTGCA
ATTCAGTGGATAGCATCCAGTAGATCAAATAAAAAAATGATAATATGTACTTTTTAAGAT
GAACAAACTACAAAATAAATCTAATAAGTTTTTGATCTTTACAAATAAAAGAATGCTTCA
ATTTTTTTGAAGCTTGTTATGGATTATCCAAACTCTAAATACATGGAGGATTACACGCTT
TTAGAATACTTAATAGAATTAGGAAAAGAAAAAGCAACATCAAAAAATTCTTGA


>TTHERM_00294690(protein)
MIEAEKQENKKIQDYQFPLPQKNSELWIIQKKTLQDLSSGKQKLDSFQSLESILEILRDS
KNQNDEKYFNLKAVFEQLDKEEQTYFLEQFIPKICQLVLKIKKKQLKNQIPKESKIYEAA
FSREEISYYVSCMFLCILKDQDRKIYKDFRLIYLKDLVQQINIRRQEKIKCFYEYLKQAL
DFSEKESKEVVIFQRINCGQLEDYENWVDKLKAIKLKNVQLTDDKLIEDFPGTLQVDFAN
CDIGGGILGNGLVQEEIRFCVCPEMLVSLLVFDQSMEANEVIIMKGIKQYSDYQGYSNSF
RFVKMGNSKIQKQKRNNPQTILAIDALCFNSSDNQFSEVNVSRELNKSYMGFKQEDQLKT
ISTGKWGCGAFLGVFDLKFAIQWIASSRSNKKMIICTFQDEQTTKQIQQVFDLYKQKNAS
IFLKLVMDYPNSKYMEDYTLLEYLIELGKEKATSKNS


>TTHERM_00294690(gene)
ATGATCGAAGCGGAAAAATAAGAAAATAAAAAAATCTAAGATTATTAATTTCCATTACCA
TAAAAAAATAGTGAACTTTGGATAATTTAAAAAAAAACTCTCTAAGATTTAAGCTCAGGA
AAATAAAAACTAGATAGCTTTTAATCTCTAGAGTCTATTTTAGAAATATTGAGAGACAGT
AAAAACTAAAACGATGAGAAGTATTTTAACCTAAAAGCTGTATTTGAATAGCTTGATAAA
GAAGAGCAAACATATTTCTTGGAATAGTTCATTCCTAAAATATGCTAGCTTGTTCTAAAA
ATTAAAAAGAAGTAATTAAAAAATTAGATTCCAAAAGAATCTAAGATTTATGAAGCTGCT
TTCTCTAGAGAAGAAATATCTTACTATGTTAGCTGTATGTTTTTATGTATACTCAAAGAC
TAAGACAGAAAAATATATAAAGATTTTAGATTAATATACCTCAAAGACCTAGTGTAATAA
ATTAACATACGCAGATAAGAAAAAATAAAATGCTTTTATGAATACTTGAAGCAAGCTTTA
GACTTTTCGGAAAAAGAATCTAAAGAGGTGGTTATCTTCTAAAGAATTAATTGTGGTCAA
TTAGAAGATTATGAAAATTGGGTTGACAAATTAAAGGCTATTAAGTTAAAAAATGTTTAA
CTAACAGATGATAAGCTAATCGAAGACTTTCCAGGTACCCTTCAAGTAGATTTTGCAAAT
TGTGATATAGGGGGAGGTATTTTAGGTAATGGATTGGTTTAAGAAGAAATAAGATTTTGT
GTATGTCCTGAAATGTTAGTAAGCTTGCTAGTTTTTGATTAATCTATGGAAGCAAATGAA
GTAATTATAATGAAAGGAATTAAATAGTATTCTGATTATTAAGGTTATAGTAATTCATTT
AGATTCGTTAAAATGGGAAATTCTAAGATTTAAAAGTAGAAAAGAAACAACCCTTAAACG
ATATTAGCTATAGATGCACTATGTTTCAATAGCTCTGACAATTAATTTTCTGAAGTAAAT
GTTAGCAGAGAGCTTAATAAATCGTATATGGGATTTAAATAAGAAGATTAATTAAAAACA
ATTTCAACTGGTAAATGGGGATGTGGTGCATTTCTAGGTGTATTTGATTTAAAATTTGCA
ATTCAGTGGATAGCATCCAGTAGATCAAATAAAAAAATGATAATATGTACTTTTTAAGAT
GAACAAACTACAAAATAAATCTAATAAGTTTTTGATCTTTACAAATAAAAGAATGCTTCA
ATTTTTTTGAAGCTTGTTATGGATTATCCAAACTCTAAATACATGGAGGATTACACGCTT
TTAGAATACTTAATAGAATTAGGAAAAGAAAAAGCAACATCAAAAAATTCTTGA