Identifiers and Description

Gene Model Identifier

TTHERM_00149900

Standard Name

PAP3 (Poly(A) Polymerase)

Aliases

PreTt20750 | 12.m00424 | 3700.m00145

Description

Poly polymerase central domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • polynucleotide adenylyltransferase activity (IEA) | GO:0004652
  • protein tyrosine/serine/threonine phosphatase activity (IEA) | GO:0008138

Biological Process

Domains

  • ( PF01909 ) Nucleotidyltransferase domain
  • ( PF04928 ) Poly(A) polymerase central domain
  • ( PF00782 ) Dual specificity phosphatase, catalytic domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00149900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05053.19.997093137033517e-262poly polymerase central domain
-containing protein (597 aa)
DictyBaseDDB_G02882591.9994274381022833e-63papA on chromosome: 5 position
1302980 to 1305635
WormBaseWBGene000117912.9992141389250636e-57status:Partially_confirmed U
niProt:Q09995 protein_id:CAA
87419.1
OxytrichaContig11888.0.g84.998711177326993e-55Poly(A) polymerase central dom
ain
SGDYKR002W1.999002769139511e-37PAP1 Poly(A) polymerase, one o
f three factors required for m
RNA 3-end polyadenylation, for
ms multiprotein complex with p
olyadenylation factor I (PF I)
, also required for mRNA nucle
ar export; may also polyadenyl
ate rRNAs; required for gene l
ooping
Stentor CoeruleusSteCoe_98071.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149900(coding)
ATGAGTGGTATTAACCCTTTAGTTTAAGATATGAGTAACATAGATCCACGAGCTGAACCA
GGATATATATTGAGTTAGGAATATCCTTAAGAACAAGACTATTAGGAAAGCAGCTACATC
AAGTAGATGATTGATAAATACTTCTATCATCCTGAAAAAGAGAAATTAAAGGAATAGATT
ATTATGAAAATTTAAGAAATAGTAAATCAGTGGATGGTAAATATCAACATTAATGAGAGA
AAAATCCCTGAGCAAGTAGCTCACATGTAACTTGCAAGAGTTTTGCCTTTTGGTAGTTAT
TTTCTTGGTGTTTCAAGTGTAGATGGTGATGTTGATCTTGTTTGTATTGCACCTAACTTT
GTTGATAGATTCAAACATTTTAATGGATAACTTTATGATATGATTTCAAATATGGATGGA
GTAGAATATCATAATAACGTTATTGATGCAAAAGTTCCTATTATGTAATTTGAAATCCAG
GGAGTACCTATAGATATTTCTTTTGCATAGCTTGATGTAGAAACTCTGCCAGATGATATT
GATAAGCAAATACCTGATACACATTTAACTATGATGGATGAAAGGGATAAGCTGAGTATA
AATGGTTATAGATGTAACTAAGCTATTATAAGGTACGTCACTGAGCACAGTGAGGATAAG
CAATAAAGCAAGCAGAGATTTTAAGAATCTCTTAAGGTTATAAAAATATGGGCAAGAAAT
AATGGAATTTATGAAAACAGATTAGGCTATTTAGGTGGTATAAGTTGGGCACTTTTGCTA
GCTAAAATATGCCAAATGTTCCCCAACCTAGAAGTTAATGGAATCATAGAGCAATTCTTT
TTATAATATTCTTCTTGGAAATGGCCAACTATGGAGGTTCTGTTAGGGCCATTTAGCTAA
CCTGAAGAGAGATAAAAAAACTAAAAATTTGAAATGTCAATTTACACTCCTGCTTATCCA
GAATATAATTCTACTGAAAGAGTTAAAAAAATAAATTTGGAGATTATTGACTATAAAATA
AAGGAAGCAAACAGAATTATTCAAGAAGAAATTAAAACAGGACAAGCTCCATGGGATAGG
TTGATATAGGAAGAAGATTTTTTAAATAAGTATACCAAATTTATTGAGATAGACTTGATT
AGAATTGAGCGCGATGAAACTATGAGAGAGTTTAAGACTCAGTAAGATAAACTTTCAGTT
AAATTGCTTACACTGTTTGAATTTTTCTCTCAAAAAAAACCCTAAGAGCTAGAGATTAGA
CCTTGGCCTTTCTTTTATAAAAAGAAAGATCAAAAGTATCCTCAGTGTTCAGCCTTTTTG
ATAGGCATAAAAGCCAAAAGCCATATTTAAGAAGAGTATAGTTTCAAGAATTGCATTTAA
GAATTTGCTATGTAGCAAAGAAAATCGCTTGATGCATTAACTAATTGCATGATTAGAGTA
TTTTAGGCAACTAAGTAAGATTTAAACGACATAGCATTTACTGAAGAGGACGAATAACAA
TTTTAAAATTAAAATGATTTCTAAGAGAATGAAGACTATCAAAATTTAAATCAAAAAAGA
TAAAATGATAATATCCATGATTACGAAAAGCAATAGCCATACAAAAAGTTAAAAACCTAT
CAAGACAATGATGAAAGTTAAAATGATTAATAAAACTAAAATAATGAAAATGAAGATTAC
AACAACTAAGAACAAGAGTACGATTAAGGATAATAAGATTATTAAGAAAATAACGGTGAT
GCAAATGATTAAGAAAATAATGACAATATGGATGATTTTCTATGA


>TTHERM_00149900(protein)
MSGINPLVQDMSNIDPRAEPGYILSQEYPQEQDYQESSYIKQMIDKYFYHPEKEKLKEQI
IMKIQEIVNQWMVNININERKIPEQVAHMQLARVLPFGSYFLGVSSVDGDVDLVCIAPNF
VDRFKHFNGQLYDMISNMDGVEYHNNVIDAKVPIMQFEIQGVPIDISFAQLDVETLPDDI
DKQIPDTHLTMMDERDKLSINGYRCNQAIIRYVTEHSEDKQQSKQRFQESLKVIKIWARN
NGIYENRLGYLGGISWALLLAKICQMFPNLEVNGIIEQFFLQYSSWKWPTMEVLLGPFSQ
PEERQKNQKFEMSIYTPAYPEYNSTERVKKINLEIIDYKIKEANRIIQEEIKTGQAPWDR
LIQEEDFLNKYTKFIEIDLIRIERDETMREFKTQQDKLSVKLLTLFEFFSQKKPQELEIR
PWPFFYKKKDQKYPQCSAFLIGIKAKSHIQEEYSFKNCIQEFAMQQRKSLDALTNCMIRV
FQATKQDLNDIAFTEEDEQQFQNQNDFQENEDYQNLNQKRQNDNIHDYEKQQPYKKLKTY
QDNDESQNDQQNQNNENEDYNNQEQEYDQGQQDYQENNGDANDQENNDNMDDFL


>TTHERM_00149900(gene)
ATGAGTGGTATTAACCCTTTAGTTTAAGATATGAGTAACATAGATCCACGAGCTGAACCA
GGATATATATTGAGTTAGGAATATCCTTAAGAACAAGACTATTAGGAAAGCAGCTACATC
AAGTAGATGATTGATAAATACTTCTATCATCCTGAAAAAGAGAAATTAAAGGAATAGATT
ATTATGAAAATTTAAGAAATAGTAAATCAGTGGATGGTAAATATCAACATTAATGAGAGA
AAAATCCCTGAGCAAGTAGCTCACATGGTATTTATTTTTATTTTTTTATTTTTTACTAAG
CATGCTTAAGTTTAGTATTGAAATTTTGCTAAATTTCAGAGATGTAAATTCTTTTTAAAA
TGTTAGTAACTTGCAAGAGTTTTGCCTTTTGGTAGTTATTTTCTTGGTGTTTCAAGTGTA
GATGGTGATGTTGATCTTGTTTGTATTGCACCTAACTTTGTTGATAGATTCAAACATTTT
AATGGATAACTTTATGATATGATTTCAAATATGGATGGAGTAGAATATCATAATAACGTT
ATTGATGCAAAAGTTCCTATTATGTAATTTGAAATCCAGGGAGTACCTATAGATATTTCT
TTTGCATAGCTTGATGTAGAAACTCTGCCAGATGATATTGATAAGCAAATACCTGATACA
CATTTAACTATGATGGATGAAAGGGATAAGCTGAGTATAAATGGTTATAGATGTAACTAA
GCTATTATAAGGTACGTCACTGAGCACAGTGAGGATAAGCAATAAAGCAAGCAGAGATTT
TAAGAATCTCTTAAGGTTATAAAAATATGGGCAAGAAATAATGGAATTTATGAAAACAGA
TTAGGCTATTTAGGTGGTATAAGTTGGGCACTTTTGCTAGCTAAAATATGCCAAATGTTC
CCCAACCTAGAAGTTAATGGAATCATAGAGCAATTCTTTTTATAATATTCTTCTTGGAAA
TGGCCAACTATGGAGGTTCTGTTAGGGCCATTTAGCTAACCTGAAGAGAGATAAAAAAAC
TAAAAATTTGAAATGTCAATTTACACTCCTGCTTATCCAGAATATAATTCTACTGAAAGA
GTTAAAAAAATAAATTTGGAGATTATTGACTATAAAATAAAGTAGAAATATTATTTTATT
TTTTTAAAAGTTTATCAAGCAATTCATTTTTATGTTTAGATTTCTAATTTTTCAATCGAT
TTTGTAAATTATAAAATTTAAATATTTTAAAAAATTATTTTAGGGAAGCAAACAGAATTA
TTCAAGAAGAAATTAAAACAGGACAAGCTCCATGGGATAGGTTGATATAGGAAGAAGATT
TTTTAAATAAGTATACCAAATTTATTGAGATAGACTTGATTAGAATTGAGCGCGATGAAA
CTATGAGAGAGTTTAAGACTCAGTAAGATAAACTTTCAGTTAAATTGCTTACACTGTTTG
AATTTTTCTCTCAAAAAAAACCCTAAGAGCTAGAGATTAGACCTTGGCCTTTCTTTTATA
AAAAGAAAGATCAAAAGTATCCTCAGTGTTCAGCCTTTTTGATAGGCATAAAAGCCAAAA
GCCATATTTAAGAAGAGTATAGTTTCAAGAATTGCATTTAAGAATTTGCTATGTAGCAAA
GAAAATCGTAAGTTTATTTTATTCATTAAAGTAGGATTAAAATAAAAATAATTTATAATA
TAGGCTTGATGCATTAACTAATTGCATGATTAGAGTATTTTAGGCAACTAAGTAAGATTT
AAACGACATAGCATTTACTGAAGAGGACGAATAACAATTTTAAAATTAAAATGATTTCTA
AGAGAATGAAGACTATCAAAATTTAAATCAAAAAAGATAAAATGATAATATCCATGATTA
CGAAAAGCAATAGCCATACAAAAAGTTAAAAACCTATCAAGACAATGATGAAAGTTAAAA
TGATTAATAAAACTAAAATAATGAAAATGAAGATTACAACAACTAAGAACAAGAGTACGA
TTAAGGATAATAAGATTATTAAGAAAATAACGGTGATGCAAATGATTAAGAAAATAATGA
CAATATGGATGATTTTCTATGA