Identifiers and Description

Gene Model Identifier

TTHERM_00151370

Standard Name

PAP1 (Poly(A) Polymerase)

Aliases

PreTt20798 | 12.m00472 | 3700.m00192

Description

Poly polymerase central domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF06519 ) TolA protein
  • ( PF00904 ) Involucrin repeat
  • ( PF01909 ) Nucleotidyltransferase domain
  • ( PF04928 ) Poly(A) polymerase central domain
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( PF04926 ) Poly(A) polymerase predicted RNA binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00151370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05095.19.997093137033517e-262poly polymerase central domain
-containing protein (1769 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151370(coding)
ATGTAAAAAAAGGAAATTAAAAAAGAGAAAGTATATGACTCTGATAATGATAGCGTAATA
TCATCTTCAGAGTCAGATAGAAGCACTTCTCCTCAACAAAAAAGTAAGAAATAAAAAATT
GTTTCCAACATTTCATCTCCAAACCTAAATCTGCCAAATAAGTAATCAGCTGAAAATAAT
ACTGTAATTTTTACAAAAATTAGAGTTATTTCTTTTCTTTCCAATAATAAAATTATTTAT
AACTTATAATCATATGTTGCTTATTGTTTATTATAATTTGTTTAGAAAAATCAACAAGGG
AGTCTGAATAGCTCTCTAATGTAATCTAGAAGCAATATTTTAAGCTAGATGACACCACAG
TAGCAGAGTTTAAATCAAATTCGGTCAATTATATAATCTTTTTATGTAAAGCAACAGCTT
CCATAGCAATAAAATAGCTAGATAAATTAGCATTAAAGTGATTTGTAGTAATCTTAAATA
AAGATGAGTTTGTTGGAATAACAAAATAGATAATATCAATAAAAAATAAAGACCATAGAG
TAAGCTAAAAATAGCGATTCAAAAGTCATTAAAAATTCAATTGCCCAAATATAGTCCCAG
CTCTTTGATATACGACATAAAGTGGAGTCAATGAATAGCAAATCGAAAGAAAAAAATCAA
AAGAAAACAAAATAAAATGAGAAAAATAGCGATGAGCACAATAAAATTAAGCAGAAAGAA
AAGAAAATTAAAAAGAAAAGCGATTAGGAAAAAGACACATCAGTTTCTAGCTTAACAAGC
AGTGAAGGTGATGAAAAATCTTTGGTAGAAAGCTTATCAGAGGATGAGGATTCAATGATT
GAATACTCTAGCAATAAACATAATTCAAAAAACAAAAGTAAAAAAAAGAATAAAAACTCT
GGAATAACTGAAAACATAAAAGGCTACTTAATACTGAATGCCCATAAATTATAGCATGAA
GGGAAAAAAAATTAACTGTTGAAAGAAATTTTGAATAAAAAAATTCCTGATCAAACAACT
TTAAGCAATCATTTAGTGATGGAAAGATATGATATAGTATTAAGAGATATTCTTGATGTT
TTTTTAGAGTATTTATTACGTAGTGAGCCACTTCATGTAAACACAGCTTATATTTTGTAA
ACAGAAAAAAACAATTTGTTAAAGAAAAGTATTTAAACTAATTAAATAAAATAGATCAAT
GCCTCACCTTAAAAATAATAATTTGATGTTCTAAAAAAGCATGAGATTAATTTAAGCTAA
AAAAATAATTAAAATGCAACTAATTTTGTAAGTTCTGAACATAATCCCCTCTATTCTTAA
AATAGACTAATAACTAACGAATCTAATAGTGGTGGATAGATGCCATACTCTAATAATACA
ATATAACCGTTTACTCATTCAATTTCAAAATCTAATTCTTTGAATCCTACTATTTAGTAA
ATTTCATAAAATAATATTGATTAAATTTCATATAGAAAATCTTTAAATAACGATTCAAGA
ATGTAATAATTATTATCTCCTCCTTTAAATTATTCAAATTAACAAAGTTATCCAGTAGTT
AATATTGACTGCATATCAAATTTAAATGATCATTAGACTATTTTAAATTAAGGAATAATT
GGATCTAATGGCCGTAATCCTTCTTCAACTAAAAGTGCCTCTAGCAAATAAATTTCATTT
CACAATTAAGTTTCATCATAAAATTAAAATTTGCATCTAAATTCTGGTAATAGTAGGGGT
TCAATTGACTGGTATTAGTAGTAGATGAAAACCAATAAAAAATTTCCATAGCAAATAAGC
ATGACTTAGCAATCTTCATCACGTTTGAACAGAGAAGGAAGCTAAGGAATATTAAAACAA
AATAATGTTTCATATTTTATCAACACTGAAGATTAAGGATTTGAATCAAAAGGTAGTGCA
AGTACGAAAATGAGTGAAAATGCTCGTAAAAACCAGAGATTAAACCATGCAATTAGTGAA
AGTTAAATAAATTTATTAAAGTAAAACTAAATATAAAAATAATTTTTATAATAACAATAA
TACCAGCAAGGTATTAACCAAATTCCTTAAATTCTTTAAAACAACCAAATTCAAGATAAT
TTCGGAATTATACACTCATTTTCTAATTTTTAAAATTCTTTGTCTCCAAAAAATAATTAA
GATCTCCAAAGTGCAAGAAATGCAAATAACTTAAAAATAAATCAAGTAGAAAGTTTAATG
AGCAGCTAATTCTAAAATAGTAATTAAGAACTCAATAATGCGCCATTATATGGCAATCAA
TAAGGAATCATTTCACAGATAGGAGGAGGGAACACTTCAAATTTATCATAAAACCACTAA
TCTCTCTTTTCATCTCCTAATAAGCAGGCTTAGCTCTTTTAATTCTAACACAAGTATTCA
TCTTCTCTTCCTTTCGAGTCATTTATGAATTTAAATGCAAGTACGTCAAAAAACAATGAC
TCATTAGAGCACAACCACAGTAGATTTTTATAGAGTACTTCCAACCCATCAAGAGATTAC
TATAGTCCTGACTTTAAATAGAGGATGATGGTGAACGGCTTTAGTAAAGAAATCCTTAAT
ATTTATCCAGAGTAGCTTTTCTTTTAGAATGATACCAATAATTTACATGAAAGATATTAA
AACTAGCAAATCTAATTAAATAATTAAGTGCTAAGAAATGATCAAGATTTTCAAAGTCAA
GAAGATTATAATAACCATCAAATATCTTAGCAAGAGAGCTAAGACTTCAATAAATTAACT
AAATCAGCAAGCATTTAAAAAAATATGTAAATGAATAGTTCAGATTAAATTGTGAGTGAG
GAAAATTACTAAGAAGACACTACAAGTATACAAGAGTAAAGCTAAAATAGTAGATAAAAA
ATAGCTCATTCAAAGTCTTTAAACTTATTGATGAATAAATCCAAAATTCCATCATTTAGC
CCTGAAAATACACCAACAAGTTTAAAGAGCCCTTCAATTATAAAAAAGAATCCCTAGTTA
AAATTAATGCCATGTCATAAACACAATAAAAGTGCTACAATAGTTGTCAAAAGAAAGAAT
TCAGACAACAGCGATCATTCAAATTCAATTTCAAATATGACCAATAATAATAATAATATT
AAGCAATAGCAATCAAACTAATAAAAATGCAGTAATTGCTTAATCATAAATAATAGAGAG
GAGGTTAAGTAAAGGTTTTAAAAGCTGCCACCTAGCATAGAATAAGTTGGTAGAAAGGGG
AAAAACAGTTCACATAATAATAACATAAAGGAAATTTTTAATTATAATTTAGAAAAATAA
CAATCAACTTCATAAAAATGA


>TTHERM_00151370(protein)
MQKKEIKKEKVYDSDNDSVISSSESDRSTSPQQKSKKQKIVSNISSPNLNLPNKQSAENN
TVIFTKIRVISFLSNNKIIYNLQSYVAYCLLQFVQKNQQGSLNSSLMQSRSNILSQMTPQ
QQSLNQIRSIIQSFYVKQQLPQQQNSQINQHQSDLQQSQIKMSLLEQQNRQYQQKIKTIE
QAKNSDSKVIKNSIAQIQSQLFDIRHKVESMNSKSKEKNQKKTKQNEKNSDEHNKIKQKE
KKIKKKSDQEKDTSVSSLTSSEGDEKSLVESLSEDEDSMIEYSSNKHNSKNKSKKKNKNS
GITENIKGYLILNAHKLQHEGKKNQLLKEILNKKIPDQTTLSNHLVMERYDIVLRDILDV
FLEYLLRSEPLHVNTAYILQTEKNNLLKKSIQTNQIKQINASPQKQQFDVLKKHEINLSQ
KNNQNATNFVSSEHNPLYSQNRLITNESNSGGQMPYSNNTIQPFTHSISKSNSLNPTIQQ
ISQNNIDQISYRKSLNNDSRMQQLLSPPLNYSNQQSYPVVNIDCISNLNDHQTILNQGII
GSNGRNPSSTKSASSKQISFHNQVSSQNQNLHLNSGNSRGSIDWYQQQMKTNKKFPQQIS
MTQQSSSRLNREGSQGILKQNNVSYFINTEDQGFESKGSASTKMSENARKNQRLNHAISE
SQINLLKQNQIQKQFLQQQQYQQGINQIPQILQNNQIQDNFGIIHSFSNFQNSLSPKNNQ
DLQSARNANNLKINQVESLMSSQFQNSNQELNNAPLYGNQQGIISQIGGGNTSNLSQNHQ
SLFSSPNKQAQLFQFQHKYSSSLPFESFMNLNASTSKNNDSLEHNHSRFLQSTSNPSRDY
YSPDFKQRMMVNGFSKEILNIYPEQLFFQNDTNNLHERYQNQQIQLNNQVLRNDQDFQSQ
EDYNNHQISQQESQDFNKLTKSASIQKNMQMNSSDQIVSEENYQEDTTSIQEQSQNSRQK
IAHSKSLNLLMNKSKIPSFSPENTPTSLKSPSIIKKNPQLKLMPCHKHNKSATIVVKRKN
SDNSDHSNSISNMTNNNNNIKQQQSNQQKCSNCLIINNREEVKQRFQKLPPSIEQVGRKG
KNSSHNNNIKEIFNYNLEKQQSTSQK


>TTHERM_00151370(gene)
ATGTAAAAAAAGGAAATTAAAAAAGAGAAAGTATATGACTCTGATAATGATAGCGTAATA
TCATCTTCAGAGTCAGATAGAAGCACTTCTCCTCAACAAAAAAGTAAGAAATAAAAAATT
GTTTCCAACATTTCATCTCCAAACCTAAATCTGCCAAATAAGTAATCAGCTGAAAATAAT
ACTGTAATTTTTACAAAAATTAGAGTTATTTCTTTTCTTTCCAATAATAAAATTATTTAT
AACTTATAATCATATGTTGCTTATTGTTTATTATAATTTGTTTAGAAAAATCAACAAGGG
AGTCTGAATAGCTCTCTAATGTAATCTAGAAGCAATATTTTAAGCTAGGTAAATTTTAAA
TTATTGTTGCAATGCTAACATTTTGTTAGCATATACAATTTTGCAGAACTCTACAAATAA
AATTAAATTGAACTCATAATATAAATAGATGACACCACAGTAGCAGAGTTTAAATCAAAT
TCGGTCAATTATATAATCTTTTTATGTAAAGCAACAGCTTCCATAGCAATAAAATAGCTA
GATAAATTAGCATTAAAGTGATTTGTAGTAATCTTAAATAAAGATGAGTTTGTTGGAATA
ACAAAATAGATAATATCAATAAAAAATAAAGACCATAGAGTAAGCTAAAAATAGCGATTC
AAAAGTCATTAAAAATTCAATTGCCCAAATATAGTCCCAGCTCTTTGATATACGAGTAAA
ATAATATTTAAAAAAATATTTTTAGAGCATTTTATTTATTATTTGTTTTATATCAAAACT
TAACTGAAGCATAAAGTGGAGTCAATGAATAGCAAATCGAAAGAAAAAAATCAAAAGAAA
ACAAAATAAAATGAGAAAAATAGCGATGAGCACAATAAAATTAAGCAGAAAGAAAAGAAA
ATTAAAAAGAAAAGCGATTAGGAAAAAGACACATCAGTTTCTAGCTTAACAAGCAGTGAA
GGTGATGAAAAATCTTTGGTAGAAAGCTTATCAGAGGATGAGGATTCAATGATTGAATAC
TCTAGCAATAAACATAATTCAAAAAACAAAAGTAAAAAAAAGAATAAAAACTCTGGAATA
ACTGAAAACATAAAAGGCTACTTAATACTGAATGCCCATAAATTATAGCATGAAGGGAAA
AAAAATTAACTGTTGAAAGAAATTTTGAATAAAAAAATTCCTGATCAAACAACTTTAAGC
AATCATTTAGTGATGGAAAGATATGATATAGTATTAAGAGATATTCTTGATGTTTTTTTA
GAGTATTTATTACGTAGTGAGCCACTTCATGTAAACACAGCTTATATTTTGTAAACAGAA
AAAAACAATTTGTTAAAGAAAAGTATTTAAACTAATTAAATAAAATAGATCAATGCCTCA
CCTTAAAAATAATAATTTGATGTTCTAAAAAAGCATGAGATTAATTTAAGCTAAAAAAAT
AATTAAAATGCAACTAATTTTGTAAGTTCTGAACATAATCCCCTCTATTCTTAAAATAGA
CTAATAACTAACGAATCTAATAGTGGTGGATAGATGCCATACTCTAATAATACAATATAA
CCGTTTACTCATTCAATTTCAAAATCTAATTCTTTGAATCCTACTATTTAGTAAATTTCA
TAAAATAATATTGATTAAATTTCATATAGAAAATCTTTAAATAACGATTCAAGAATGTAA
TAATTATTATCTCCTCCTTTAAATTATTCAAATTAACAAAGTTATCCAGTAGTTAATATT
GACTGCATATCAAATTTAAATGATCATTAGACTATTTTAAATTAAGGAATAATTGGATCT
AATGGCCGTAATCCTTCTTCAACTAAAAGTGCCTCTAGCAAATAAATTTCATTTCACAAT
TAAGTTTCATCATAAAATTAAAATTTGCATCTAAATTCTGGTAATAGTAGGGGTTCAATT
GACTGGTATTAGTAGTAGATGAAAACCAATAAAAAATTTCCATAGCAAATAAGCATGACT
TAGCAATCTTCATCACGTTTGAACAGAGAAGGAAGCTAAGGAATATTAAAACAAAATAAT
GTTTCATATTTTATCAACACTGAAGATTAAGGATTTGAATCAAAAGGTAGTGCAAGTACG
AAAATGAGTGAAAATGCTCGTAAAAACCAGAGATTAAACCATGCAATTAGTGAAAGTTAA
ATAAATTTATTAAAGTAAAACTAAATATAAAAATAATTTTTATAATAACAATAATACCAG
CAAGGTATTAACCAAATTCCTTAAATTCTTTAAAACAACCAAATTCAAGATAATTTCGGA
ATTATACACTCATTTTCTAATTTTTAAAATTCTTTGTCTCCAAAAAATAATTAAGATCTC
CAAAGTGCAAGAAATGCAAATAACTTAAAAATAAATCAAGTAGAAAGTTTAATGAGCAGC
TAATTCTAAAATAGTAATTAAGAACTCAATAATGCGCCATTATAGTAATTTTTTTATAGA
ATTATTTGTTTTTTAATATTAAAATAATAACGATAGTGGCAATCAATAAGGAATCATTTC
ACAGATAGGAGGAGGGAACACTTCAAATTTATCATAAAACCACTAATCTCTCTTTTCATC
TCCTAATAAGCAGGCTTAGCTCTTTTAATTCTAACACAAGTATTCATCTTCTCTTCCTTT
CGAGTCATTTATGAATTTAAATGCAAGTACGTCAAAAAACAATGACTCATTAGAGCACAA
CCACAGTAGATTTTTATAGAGTACTTCCAACCCATCAAGAGGTAACTTACTTATTTCATA
AACGTTAATAATTTTACAAACTTGATATCATTAGATTACTATAGTCCTGACTTTAAATAG
AGGATGATGGTGAACGGCTTTAGTAAAGAAATCCTTAATATTTATCCAGAGTAGCTTTTC
TTTTAGAATGATACCAATAATTTACATGAAAGATATTAAAACTAGCAAATCTAATTAAAT
AATTAAGTGCTAAGAAATGATCAAGATTTTCAAAGTCAAGAAGATTATAATAACCATCAA
ATATCTTAGCAAGAGAGCTAAGACTTCAATAAATTAACTAAATCAGCAAGCATTTAAAAA
AATATGTAAATGAATAGTTCAGATTAAATTGTGAGTGAGGAAAATTACTAAGAAGACACT
ACAAGTATACAAGAGTAAAGCTAAAATAGTAGATAAAAAATAGCTCATTCAAAGTCTTTA
AACTTATTGATGAATAAATCCAAAATTCCATCATTTAGCCCTGAAAATACACCAACAAGT
TTAAAGAGCCCTTCAATTATAAAAAAGAATCCCTAGTTAAAATTAATGCCATGTCATAAA
CACAATAAAAGTGCTACAATAGTTGTCAAAAGAAAGAATTCAGACAACAGCGATCATTCA
AATTCAATTTCAAATATGACCAATAATAATAATAATATTAAGCAATAGCAATCAAACTAA
TAAAAATGCAGTAATTGCTTAATCATAAATAATAGAGAGGAGGTTAAGTAAAGGTTTTAA
AAGCTGCCACCTAGCATAGAATAAGTTGGTAGAAAGGGGAAAAACAGTTCACATAATAAT
AACATAAAGGAAATTTTTAATTATAATTTAGAAAAATAACAATCAACTTCATAAAAATGA