Identifiers and Description

Gene Model Identifier

TTHERM_001295283

Standard Name

PAMD1 (PArtner of McmD1)

Aliases

None

Description

Required for homologous recombination in meiosis; interacts with Mcmd1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_001295283

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18594.19.997093137033517e-262hypothetical protein (1668 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_001295283(coding)
ATGGAGAAATTTATTAAATTTTTGGAAGAAGACGTAGATTTTAATATAGAAATTCATAAT
AAGATTTAAGATTTAAAAGATTAAAAGTTAATAGATCCTAGCTTTATTGTTTTTAAGTGC
AGTCTCAGATTGGATATTATATAGTTGAATGACTAAGATTTAAACCTTTCCATTTATATT
TAGCAAAATTACCCTAATTTAGATTCGTTAATTAGAGATTATGTATAAAAGATTTTATCT
GAAGATAAATAATTGAGGAATATATAAATAAGACAAGAATAAATACTTCCTGATATCGAG
ATCATCAATGGGAATCTTACTAATAATCTTAATATTTATGCATAGAAAGGTATTCTTCAG
AATTCTTTGTTATAAAATTCTTTTGTTCAAGGACAGCTAGTTCTTATTGAATATTTTTAA
GTATTAAAAATTTTTCCTTTAGAGAATTATTACTCTATTAAGAGATATTCTTATTACTGT
GGTTGCAACAATAATGATTACAAGCTTTAAAATACTAATTTAATTCTTCATATTATTGAA
AACAATTAATCTGCATCCCTAAACAAACAGAGCTCTAATTTAATTAAAAATTTAAGCTGT
GATATATGTCATTAGGAAATGTATGAAGATAAAGAAAAGAGTAAACCTGAATTATGCCAA
AAAGTACTTATATATATTCCAGAGAGATATAATTCAACCAGAAATAGTTTATTAAACGGT
TTTTAAAAAGAAGAGGGAAAACTCATTGAAATGTTTTTAGAAAAATAATACTGCAACAGT
CTTTCATTAAATTAAACTTATAGCTGTATAGCTTATTATTCCCTGGCTACGAGTAACAAA
TAAACAAAGAACGACTTTCTAACAGGTTTTAAACCTTTAAATATTACTGAACACCTGTTT
GCTTGCACAATTTCTATTAATATTAAAGATCCTAATGCTTAATTTAATTAATAAATGATA
AACTAGGTTAGTTTATTTAATTGTATCACAGAACAAGAATAATTGGAGAGTTAAATGAAA
TAAAATTCTAATGATGAAAACGAAAACTTTCATTTTAAATTTAAATAATTAATGTTTGCA
GTTGATTCATTTTTCAATGAAGCAACAAAGTTTAGCTTTTTGTAATTGAAAACTGCTTTA
GTTATGAGTTATGTACTTGCTAATTCAAATAGGATTCTTCAAAAAAATAGCAGTCTCAAT
AGAGAAGGATCATTTAGTTAATTAAATGTACTTTTTTAATGTGAAAGCCAATTTGTCGAT
AGCATAATAGAAGAAATTTTGATGACATTTGGATATCTTTAAAGTTTCAATGTATTTGAT
TGTCTTCTTTAATTTGATATTGCTTCATCCCTTGTAAAATCGAATAATAGCATTCTTCTG
ATAAAAAATATTCAAGATATTTCGAAGCAACAATAAGAACAACTAAATAAAATACTATAA
AATTAAGAGATTTATTTCGATCAGCTTAAAACAAAATTAAATTTAAATGTTACAATATGG
GCTTTCAATTCCACAAGTAAACAATCAGGTAAAATCAAAAAATTTAAAAGTGATAAAAAT
ATTTCTTAAAGTTTTGAGCAGTATTTTGATGTTTGCCTTTCCCAAGATAAGTCAGTATTG
TCTTTAAAGGATTACCACCTGTTGATCCAAAATGAAGTTGATATGTTTTTAGATAAAGAA
TTACAAATGGGTTAAAAATTTTCAAGAAAAGCCCATCATGAACTCTCCACTGAAAAAAAA
CACATTCACTCAAAAAGCAATAGATTCAATGAGTAAATGTCAACTCTTAAGAAAGAAAAA
AGCAGTTAAAATTAGCATGTTTAGGCGTTAATAGGTGATAACTATAAAAATAATAATGAA
GAAGAAGCGCATTGCTTACTGAACAAGTTTATCAATACTGTTAGAAATAGTATGAGTGCG
AAAGAAATAAATTATTCTACAAGCAATATTAGCAGCTTATCGAAATTCGCAATAGCTAGT
TCTATCTTCAGAAATGTTTTTATTAAAAATAATAGCCAAGAATTAATTTCATGCGAGGAA
AATAGCAGAGTAATTATAGATACCTTTGATGCCTTTTTGTCTATATTCTTTAATATTTTG
TCTAGAAAAATATTTTGTAGAGATTTAGACACAAAGTATTTCCTTTCTTTCATAGTGAAC
TATGGCAGCGGCTACTTAGAGAACTCAGAAATGAGAATTCCTTAAGAAAAAGAATTTTTC
ATCGCCTTGGAGAAGATTTAAGATTAGATTTTAGATTTTATAAGATTTTGA


>TTHERM_001295283(protein)
MEKFIKFLEEDVDFNIEIHNKIQDLKDQKLIDPSFIVFKCSLRLDIIQLNDQDLNLSIYI
QQNYPNLDSLIRDYVQKILSEDKQLRNIQIRQEQILPDIEIINGNLTNNLNIYAQKGILQ
NSLLQNSFVQGQLVLIEYFQVLKIFPLENYYSIKRYSYYCGCNNNDYKLQNTNLILHIIE
NNQSASLNKQSSNLIKNLSCDICHQEMYEDKEKSKPELCQKVLIYIPERYNSTRNSLLNG
FQKEEGKLIEMFLEKQYCNSLSLNQTYSCIAYYSLATSNKQTKNDFLTGFKPLNITEHLF
ACTISINIKDPNAQFNQQMINQVSLFNCITEQEQLESQMKQNSNDENENFHFKFKQLMFA
VDSFFNEATKFSFLQLKTALVMSYVLANSNRILQKNSSLNREGSFSQLNVLFQCESQFVD
SIIEEILMTFGYLQSFNVFDCLLQFDIASSLVKSNNSILLIKNIQDISKQQQEQLNKILQ
NQEIYFDQLKTKLNLNVTIWAFNSTSKQSGKIKKFKSDKNISQSFEQYFDVCLSQDKSVL
SLKDYHLLIQNEVDMFLDKELQMGQKFSRKAHHELSTEKKHIHSKSNRFNEQMSTLKKEK
SSQNQHVQALIGDNYKNNNEEEAHCLLNKFINTVRNSMSAKEINYSTSNISSLSKFAIAS
SIFRNVFIKNNSQELISCEENSRVIIDTFDAFLSIFFNILSRKIFCRDLDTKYFLSFIVN
YGSGYLENSEMRIPQEKEFFIALEKIQDQILDFIRF


>TTHERM_001295283(gene)
ATGGAGAAATTTATTAAATTTTTGGAAGAAGACGTAGATTTTAATATAGAAATTCATAAT
AAGATTTAAGATTTAAAAGATTAAAAGTTAATAGATCCTAGCTTTATTGTTTTTAAGTGC
AGTCTCAGATTGGATATTATATAGTTGAATGACTAAGATTTAAACCTTTCCATTTATATT
TAGCAAAATTACCCTAATTTAGATTCGTTAATTAGAGATTATGTATAAAAGATTTTATCT
GAAGATAAATAATTGAGGAATATATAAATAAGACAAGAATAAATACTTCCTGATATCGAG
ATCATCAATGGGAATCTTACTAATAATCTTAATATTTATGCATAGAAAGGTATTCTTCAG
AATTCTTTGTTATAAAATTCTTTTGTTCAAGGACAGCTAGTTCTTATTGAATATTTTTAA
GTATTAAAAATTTTTCCTTTAGAGAATTATTACTCTATTAAGAGATATTCTTATTACTGT
GGTTGCAACAATAATGATTACAAGCTTTAAAATACTAATTTAATTCTTCATATTATTGAA
AACAATTAATCTGCATCCCTAAACAAACAGAGCTCTAATTTAATTAAAAATTTAAGCTGT
GATATATGTCATTAGGAAATGTATGAAGATAAAGAAAAGAGTAAACCTGAATTATGCCAA
AAAGTACTTATATATATTCCAGAGAGATATAATTCAACCAGAAATAGTTTATTAAACGGT
TTTTAAAAAGAAGAGGGAAAACTCATTGAAATGTTTTTAGAAAAATAATACTGCAACAGT
CTTTCATTAAATTAAACTTATAGCTGTATAGCTTATTATTCCCTGGCTACGAGTAACAAA
TAAACAAAGAACGACTTTCTAACAGGTTTTAAACCTTTAAATATTACTGAACACCTGTTT
GCTTGCACAATTTCTATTAATATTAAAGATCCTAATGCTTAATTTAATTAATAAATGATA
AACTAGGTTAGTTTATTTAATTGTATCACAGAACAAGAATAATTGGAGAGTTAAATGAAA
TAAAATTCTAATGATGAAAACGAAAACTTTCATTTTAAATTTAAATAATTAATGTTTGCA
GTTGATTCATTTTTCAATGAAGCAACAAAGTTTAGCTTTTTGTAATTGAAAACTGCTTTA
GTTATGAGTTATGTACTTGCTAATTCAAATAGGATTCTTCAAAAAAATAGCAGTCTCAAT
AGAGAAGGATCATTTAGTTAATTAAATGTACTTTTTTAATGTGAAAGCCAATTTGTCGAT
AGCATAATAGAAGAAATTTTGATGACATTTGGATATCTTTAAAGTTTCAATGTATTTGAT
TGTCTTCTTTAATTTGATATTGCTTCATCCCTTGTAAAATCGAATAATAGCATTCTTCTG
ATAAAAAATATTCAAGATATTTCGAAGCAACAATAAGAACAACTAAATAAAATACTATAA
AATTAAGAGATTTATTTCGATCAGCTTAAAACAAAATTAAATTTAAATGTTACAATATGG
GCTTTCAATTCCACAAGTAAACAATCAGGTAAAATCAAAAAATTTAAAAGTGATAAAAAT
ATTTCTTAAAGTTTTGAGCAGTATTTTGATGTTTGCCTTTCCCAAGATAAGTCAGTATTG
TCTTTAAAGGATTACCACCTGTTGATCCAAAATGAAGTTGATATGTTTTTAGATAAAGAA
TTACAAATGGGTTAAAAATTTTCAAGAAAAGCCCATCATGAACTCTCCACTGAAAAAAAA
CACATTCACTCAAAAAGCAATAGATTCAATGAGTAAATGTCAACTCTTAAGAAAGAAAAA
AGCAGTTAAAATTAGCATGTTTAGGCGTTAATAGGTGATAACTATAAAAATAATAATGAA
GAAGAAGCGCATTGCTTACTGAACAAGTTTATCAATACTGTTAGAAATAGTATGAGTGCG
AAAGAAATAAATTATTCTACAAGCAATATTAGCAGCTTATCGAAATTCGCAATAGCTAGT
TCTATCTTCAGAAATGTTTTTATTAAAAATAATAGCCAAGAATTAATTTCATGCGAGGAA
AATAGCAGAGTAATTATAGATACCTTTGATGCCTTTTTGTCTATATTCTTTAATATTTTG
TCTAGAAAAATATTTTGTAGAGATTTAGACACAAAGTATTTCCTTTCTTTCATAGTGAAC
TATGGCAGCGGCTACTTAGAGAACTCAGAAATGGTAAATTAAACAATATTAAAAATAAAA
TTGTAAGCTTTTATTATTAAAAATGAATGTAGAGAATTCCTTAAGAAAAAGAATTTTTCA
TCGCCTTGGAGAAGATTTAAGATTAGATTTTAGATTTTATAAGATTTTGA