Identifiers and Description

Gene Model Identifier

TTHERM_00499570

Standard Name

PACRG

Aliases

PreTt08000 | 63.m00178 | 3716.m00032

Description

basal body/cilia protein; identified by proteomic analysis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00499570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09676.17.002846707792393e-180hypothetical protein (250 aa)
OxytrichaContig1359.1.g247.001959534329768e-108Parkin co-regulated protein
Stentor CoeruleusSteCoe_163022.031092662734811e-42
WormBaseWBGene000171224.0013320766793207e-25status:Partially_confirmed U
niProt:Q19060 protein_id:CCD
65912.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499570(coding)
ATGTAAAGCTTAAGCCCATCTAGAAAAGTTAAACCAAATAACACAACTCATTTATTAAAT
ATTTCATCTAAGTTCACTGGAACTGGTGGAAATTGCTCATCACTTGCTCCTAAAAAGGTA
TAACCTATCCCTAAAGTAAAAAAAACTGGTATTTTTGAAGCTAAAGCTATTGAAGCTGTT
GAAATTAATCTCTTCAAAAAGTATTATGATAGAGGTGATTTACCTATAGCAGTCAACTTC
CACGGAGCTCACCGCAAGATTTCATGGAAACTTGAACCTGAATTGTTAGATTACCATTTA
TATTTGCCTATATTTTTTGAAGGACTTAGAGAAACTGAAGAACCCTATAAATTCTTGGCT
GATCAAGGATGTGAAGAATTACTTGCTAGAGGTGGAGCTAAAATATTTGCTGTGCTTCCT
CAATTAATTATTCCTATTAAGAAGGCACTTAGCACAAAGAGTCATCCAATTATGTGCACC
ACTTTAAAGAAAATATAAAAGTTAGTTACTTCAAGTGATATGATTGGTGAAGCTCTAGTT
CCTTACTACCGTTAAATTTTACCAGTGATGAATATGTTCAAAAATAAGAGATTGAATATT
GGAGACCATATTGACTATTCTTAAAGAAAAAATGAGAATTTATCAGATCTAATTTAGGAA
ACATTAGAAATACTTGAAAAGTATGGTGGAGAAGATGCTTACATTAATATTAAATATATG
ATTCCAACTTATGAAAGTTGCATGTTCTGA


>TTHERM_00499570(protein)
MQSLSPSRKVKPNNTTHLLNISSKFTGTGGNCSSLAPKKVQPIPKVKKTGIFEAKAIEAV
EINLFKKYYDRGDLPIAVNFHGAHRKISWKLEPELLDYHLYLPIFFEGLRETEEPYKFLA
DQGCEELLARGGAKIFAVLPQLIIPIKKALSTKSHPIMCTTLKKIQKLVTSSDMIGEALV
PYYRQILPVMNMFKNKRLNIGDHIDYSQRKNENLSDLIQETLEILEKYGGEDAYINIKYM
IPTYESCMF


>TTHERM_00499570(gene)
ATGTAAAGCTTAAGCCCATCTAGAAAAGTTAAACCAAATAACACAACTCATTTATTAAAT
ATTTCATCTAAGTTCACTGGAACTGGTGGAAGTAAAATAGCATTTCTTCATAATATAAAT
TAAAATTTCAATTCACTTTGGATTTAAGCCAAAGAAATGATCTATTGAATTATTTGCTTG
CTACTAGATATTAATTAATCATTTTTTTTAATAATTATCTTATCTTAATCTATAGATTGC
TCATCACTTGCTCCTAAAAAGGTATAACCTATCCCTAAAGTAAAAAAAACTGGTATTTTT
GAAGCTAAAGCTATGTAAATATTTTAATTTAACATTTTTTAGAGTGAAAAAGATTTAGTT
TTAAGTGAAAATATAATATATATACAGTTTCATAAAACAAAAATGAATAAATGATAATAA
ATTCTATATTCAATATGCAAATTAACATGCTAATAATCCTTTTATTAATTTCTCCTTTTT
ATAAATAATTTAAATCAGTGAAGCTGTTGAAATTAATCTCTTCAAAAAGTATTATGATAG
AGGTGATTTACCTATAGCAGTCAACTTCCACGGAGCTCACCGCAAGGTAATTTCTTATTG
ATTACATTGAATTTTATAATTAGTTTTTAGACAAATAAACAAAATTCAACTTTTTATTAA
CTTAATTAGATTTCATGGAAACTTGAACCTGAATTGTTAGATTACCATTTATATTTGCCT
ATATTTTTTGAAGGACTTAGAGAAACTGAAGAACCCTATAAAGTAAATTATTTCATAATA
ATGCCCGAAATTTTTTAATTAAAATTTGATTTAAAATCAGTTCTTGGCTGATCAAGGATG
TGAAGAATTACTTGCTAGAGGTGGAGCTAAAATATTTGCTGTGCTTCCTCAATTAATTAT
TCCTATTAAGAGTAATAAATCATTAATTTTTAATTTAAGAGAGAGTAATATTTTTCGCAA
TATATAGAGGCACTTAGCACAAAGAGTCATCCAATTATGTGCACCACTTTAAAGAAAATA
TAAAAGTTAGTTACTTCAAGTGATATGATTGGTGAAGCTCTAGTTCCTTACTACCGTAAA
ATATATTATTATTAAAACAAAAATAAAAAATAAATAATTAAATCTATTTTTGTTATAAAT
TAAGGTTAAATTTTACCAGTGATGAATATGTTCAAAAATAAGAGATGTAATTAAATTAAA
TAATTTTTATTGTTAAAATTACATAACTTCTATAAATTATAGTGAATATTGGAGACCATA
TTGACTATTCTTAAAGAAAAAATGAGAATTTATCAGATCTAATTTAGGAAACATTAGAAA
TACTTGAAAAGTATGGTGGAGAAGATGCTTACATTAATATTAAATATATGATTCCAACTT
ATGAAAGTTGCATGTTCTGA