Identifiers and Description

Gene Model Identifier

TTHERM_00804710

Standard Name

PACF2 (Proteasome Activator Complex subunit Four, second paralog)

Aliases

PreTt22743 | 136.m00113 | 3808.m00397

Description

regulator of the 20S proteasome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00804710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19948.19.997093137033517e-262hypothetical protein (2049 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00804710(coding)
ATGGCAATATAAAATTTTTAAAATAATTTTTAATTAATACTAAAAAATTTTAAATTATTT
AGATTAAGTTGTTAGTTAGATAGATAGACTTAAGTAAATGAAAAAGTAGAGAACACTTAA
TTATTACAGATTATAAATTTGGTATATCTGGTTTTAATTTGTTTGATAAAAAATAATTAT
ACAAATAAACAAACAACCAATCTGATCTTTAAATCTGATAAATTGATTAAATAAAGTGAA
TTGGATTAGATATTAAATAGTTAATAGATAGTACGTAGAATCAATAAATAAATAATAATT
TATTTGGCAGATATTAATAAAGTTAAATATTTTTTGAATAAAACAAACAATAAGAATAAC
TCATTTTAGCAAATATCATATCATATCAATAAATCAATCAATATATAGAGAATCTTTAAT
AATTACTTAAATATATTTCAGGCATTAAAAATACACAAAAAATTGTTAAAAAAGAAATAG
AAGAAAGACAACAAACAAAGCAAGCAAAAATTAATAGATCAATTTTTAAATAAAATGGAA
GTAGAAAAGGGTAAATAAGGAGAAACAAATCAGGATTAAGAGAAAAAAAATGAAAATTTA
GTAAGCAAATAGGATTAAAGCAACAACTAAAATAAGTGGCATTCTTTGAGGAAATATCTC
AATAACTAATTTCCTTGCAATAATAAGGATTTATTTGATTCTGAAAAAGAGGAATTAACA
TAGAAGTTTGACGAATAAGTCAAAAATATTTTTAATGAGAGAGATTTAAATAATGAATTT
ACATCTTTAGGCAGAAAGCGTTCTAAACTGCAATTGCTTTATGGCATAAATAATTAAGTA
AAACAGCGCTTTTAAGAAACAATGTTCTATTTGGCTATTGAAGAATAGTATATGAAGTTA
GAACCTCTTATTGCGTATCCTTTCAATAGTAATTCTACACTCAATTGGTAGCCTTTCTGG
AACTTGGTTCTTAAAATGATATTCAAAAACGATCTTTAGAACACAAATCTCCAAGAAGCA
GTTCTTCCAGAAACTATCAACTTCCTCTAAGTCATCAAGAAAATTCGCCAAAAATTTGAT
GATAGTTCTATTTAAGAAGTTTACGACTTGTACAAAAAGCTGCGATTATCAAATAGCGGA
TAACTCTCGTTGCTTTTAGTGAGATACTTTTTAAAAATATCTAGGAATACTCCTAAAGAA
TTATATTAGTAAATATTCTAAGAGTTCACTCTCTAATTAAGTTACGATTAGCCTATCAGA
AACAGATTAGTTATGCTCACCATCCTCTATAATTTAGCAAAAGCTCATCCATAGCTAGAT
TGGGAGAATTAGTATGATTAAATTTTCACATTTATCTCTAGATACTATATACAAAGAATG
CCTTTAGGTTTTACTTACTATTAGCCTTAGTAAAAATTGTACTATCTTTCTATATACAAT
CCATAGACTTTGATTATGAGTCTTTTGATAGCTTTGATAGCACCTGAGACTGAAAAGGAA
AAGCATGAAAAAATATGGAAAAATATTCATAGACTTTTCAATCTGATAAAGCAATATTTA
CATCCTAATTACGATAATACTCCGACAATTAAATTCCTCTTTTAGCAATTCTAATAATTT
GTATCAACTTTCATATGGACTCACGGCGAGTAGCAAAAATAAATCAATAACTTAGAGAAA
TAAAAGGCCAAATTAGAAAGAAAGATTAAGATTTTAAATGCTGCTTAAAAGTAAGACGAG
TAGCTAGTTTCTTAGCAAGGACTACCTGGAGATGAGCAAGATGAATTGAAAGATCAAAAT
ATAGATACTGAGTTGTTAAATGAAGATGAAGGTGGAAACATGTAAATGGAAAAGGGTATG
GACTAGTTTAAGTCATAGGCTATGGATTACGAAGGAAATGATAATCCTCAAATGCAAAAT
ATTCAAGCTAGAGTTGAAGAGGATGAAGTAGATGATGAAGATGAAAACGAAGATTCAGAT
GATGAGCAAGAAAAATTCGATAAGTTTGTAAACGAGTTCTCTGAAAAAGCTTAAAATGAG
CAAGCAGAAGAAGTAGAAAAATATCAAAAAAAGCTACAAACAGTTATTGAAAAGTTGAAT
GTAAAAAAGTAATTTGCCTTCGATAATGCTTGCAAATAGTAGTTTGAATCTATTATTGAA
GCTAATTTAATTAACATATTGGGAATAAACGACCAGAGTGGCAACATTCTCCCTTAAATT
TGCAAAGATTTGTGTTATTTTAATCCTAGCAAATTCATTCCAATCATCTTGGACAATATT
TATGAGGCTTTCGAAAAACCTGATATGAATTACTCAACTGCAATCAGTGTTTTAACTTCA
ATAATTATCCCTATGGTAGACAGAACTAACTACAAGTAAGGTCTCTATCAAATCCCAACT
CTAATGAAGAAAGTCCTTGATATTTTCAACACCAGCAATTTCTAGTTATCAGTAAAAATG
TGGAAGTTATTCGATTAGATTTTCCAAGTTGTTCCTATTTACAACGTAGATGATTTGCAA
GAAGCCTACATGGAAAAAAACCCTGGAAAATCATATAGCGATTTCTATCAAGATTTAAAC
AAAGATGAAGAAATAAACATGATAACATTTTATGAGTAGCTCCATGATGTTACCTATAAC
ATATTCTAAAAGTTCTTAAGCATCTTTGAGCATATTGACATGCCCAGATCTAAAAATACT
AGAGGATTTAGAGCAGCTGTGATATCTGTTCTAAATTTCTTCACATCAATAGCGTTTTCA
ACATCTAAAAAGCTATTTAAGCAATTGTGGTCTCATGCATTCTAATGCATCACAGATAGA
TAACAGCTTCATGCATCTAAATTTTATAGCTACTTAATACACTCATTCACTTTACGTGAT
CCTTAATTAGTTTTATAAAGCATGATTCCTTACTTATTTGATCACATCTTGATAAAGAGA
GAAAATCCTGATTTGACAGAAATAGAAAAGCAGCCTCTTTACTATTTATTATAGCAATAG
CCAAACAAGGACCATATTCTCTCTTATCAAATCGAGAGTATAAACTCTAATTCACTATTC
TGGTATCTAAACTTGCTTGAAGATACCATATTCTTTGGCAGATAAGAGATCTTAAAATAC
AAAACAGAAATCGAAACAATTATTTTCCTTTGCTTTGTTCATACAGAAACCGAATTTTCT
AAAAAGGCTTGCCAGTTGCTTTAAAAAATATTCCATTCTCTTATTACTTTTTACCCTTCA
GAAATGTTTATTTGGAGCGAAAATGAAATTGAAGATGATCTTAATTTTAAGGAAATGTAC
CATAGATACATTGGCTAGAGCAGTAAGAAGAAATTCAGTATGAAATGGCACGAACCTACT
GCTGTTGAGGTTGAATACTCAAAGGAGTTATTCTTTAGAATATATAATCCTATTCTAAAT
CATTTCAATAACAATCATTTCAAGAATTTAGAACCTATTGATGTTGACAATAATTTCACA
TAGATACTCGACGCAACTATGCATGCTCCAGATGATGCTCCCAGAAGTCTTAAAACAGAA
TTATAGAGGTCTATCATGTTGCTTTTCCATCTTTATAGCTCAATAGCTACAAGACTAAAA
TGGGGAATTGATGAATAAGATGGAATATACAAAAAATTTAGTTCTACATTCTGTCTTCCT
GAGTATGATAATATAAATAGTGAAATGATAGATTTTAGTGAAAATATGATCAATTTCATG
ATAAAAAATAATCTATTTTACGACAGCAATGTTGCTTAAGTTTATCTATCTCTGATATTA
TTTATTTTAGGAAATGATGACTAAACTGGTTACATTAATGGTATCAAAAATAAGCTCAAA
GAATTAAAGAATTAAAATTCAAATCCTTATAGATCATATCAAGGATATCCAAGATTTGTA
GAAGTTACTTCAGTTACAACACAATTCAACACTAAAGTTATTTTATATACTTTTGACACT
AAATTGAATGACAAACATTCCAAATTGCTTAAGCCACTTCTATTTTTGATACTCCACCCT
TACTAAAAGATTAGTGAAAAATCTATCAATAGCTATTTGATGATGGCTGATCTGCTCAAA
AATAAAAGTTATTATATTCAAAGCTTGAAAACATTCTGCTCATTCTTACAGGCCAAATTG
AGCAAAAAGAGCAATGATTTCTTCCCTAAAGTAATTGAAGAATGCAAAGAAAAGGATCCA
AAGCTAGTTCCTATGCTTAGCACATATTAGGACAGAACTATTTCTTCGTTAATAGTTTTG
AATTTTGTTGCAAAGAAATTCGATTAAGATTATGCTTTCGTAGTGGATACTTTGATGTCA
ATTGTAGAATCTTACAATATCTTTTTATCTAAAGACTTAAAAGATAAGATAATTGATATT
CCATTAAATTAACTAATGCACTTAGTAACTAAACTCAAAAAGTTGGATATCGCTTACAAT
TAACCAATTTAAAAGCTGGGAATTTACAAGGAAAAAAGCTAGGTTCTCTAGGAAATTCTA
TAGCAAGACAATAAAGAAAGAACTCACTAATTATAAGGAGAGCAAAAGATGCTTTAAATA
AAGGCACTGATTAAGTAGCTCTATGATAGATGCTTGTTAAATCTAGAAGACCCTACTGTC
TTCTCCAAAGAAAAGATTTTTATGATCATAATCGCAATGAAAACTGCAAACTTTACAGAT
GCCAACGACGAAAGATTTAAAAAAATATTAGAAAATGCAATTAATTTCACTAATTATGAC
AATCTTCATTCTCGTAATATAGGCAGAGCAATGCTTTTTAAGTGCATTCGTACACTCAAA
AACCAGTACAAAAAAAGGGAAGAAAAAATTACAATCGAAGACGATTATGTTAAAGATTAA
AATAAGCCTCTTGAAGAATTAAGTGCATATTTCTTGTTTAAAAAGGAAGATATTGAAGAT
AATTTCTATACAAATAGACATCAAGACTTTATCCTCTACAAAAAATCTACAACATATTTA
GAACATAAGAAGGATATTATTTTTTACTAAAAATTTTCTGATAAAGAATTTTTGAATACC
TTCCTTGAGCATATTCTGAATGATATTACGACACATACTATGGCTGAATAATCTCTAAAG
CCTAAAAATATTTTCAACACTGCAGATTTGATATTCTAATAAGAATTTGTGAAGAATTTC
AAGAAAAAGAATTTCTTTAGCGATGGGCCATCATTTTTCCATATGAAACTTCTTAAAAAG
ATATTTGGTTTACTTGGTATGCAATTTTTCGAAGTTGCCAAGGTTCATTTAGAGAAATAT
AAGAATGACTACTCAACTCTTGAAGGATCTACTATCATGAATGTACTCACTTTCAGTTGT
TTACTAGGTATTTTCTAAATAGAATAAGACGCTACTGAATAAGAGAAAGAAGAGACTTAT
AAGTATTTAATGGAGATAGTTATCGACAGAGCATACTAACTTAACTTAGAATAATTTGCT
TATTTCATGAAATACTTAGAGACAGTGATTGAAAGTATATCTTTTAGAGAATCTTAGAGA
ATTCTTGATGACATCTATAAATCTCCTAAACTAGGTAATTAGTAGGATCCTAAGTACTAA
CGTTATCTTTATACAAAGCTCCTCTAACTAAATAAATTCAACATAAAAAATTAAGAAATC
TTGGAAGGGTTAATTAATGAATTAAAAACTGTTAATCCTTTGTCTATTCAATAACTTCCT
ATATACAATCTAGTTCACAACGCTGTTTGGTCTTATCATTAGATTTCGATTGACTTTAAC
TTCTGTAAAAAGTACAACATAATTAAAGATATTGACTAATTAGTAGAACAAGGAAGGTTG
AGAAAAATTGACTCATTCCAAGCTATTAGGATTAATCCTCAAATAAATTAAATTTATGAT
TTCATTCTAAACCAATTAAACTCAGAAGATCCTGAGGTGAAGAAGAAATATTACCGTCTT
GTAAAAGTCTTTTCATCGATTTTCAAAGAAGATCATCTCTTCAAAACAGAAATCTATAAT
TCAATGAAAAGCCTTTTCCCTTACTTCATAGAATTCAAAGAAGAAGATATTGCTGATGCC
TAACTTGTTTAAGAATTTTGGTCTAATTTGATCTTCCTATCGATTCCACTTTATAACAAA
GAAACAGTATTAGAATTGCTAGAATTATGCTACAAAAACTTTAAAAACACTAACTGGAGA
ATTCGTTAGAGAGCTCTTCTATTCAATCAGTTTATTGCCTTTTTCAACTTGTATAGAATT
GGCGATTTTAACTATATTGACCCTCTTTTGGAACTTATGAACGACGAGCAAAAGCAGAAC
AAATCTATTGCTTAAAAGGTACTTTCCTTAGTTATCAAAACTCTACCTGTAGAGTAAGTA
GGAGGATTTGTAGAAAGAATGTAAAAAATGGCAGTAAGCGAAGACAAGAACTAAAAAATC
ATAGCAGTTTATTGTCTAATGAGTGTATTACTTTCTTATCCACATGAAATTAAGGAATGG
ACTGAAAATGCTATTAGGACAATTCTTAAAAATAAAAACATATCACCAGATACATTGACT
CTTCTCAAAGAATTTGGAGCTGCTTTCTTAAGAAATGCTTTACACAACAAAGTAGAAAGT
AAGCTAAAACTACCTGAAGACTTAATAATTAGACTTGAAGAAATATCTAGACCACATAAC
TACTTTGCTTGA


>TTHERM_00804710(protein)
MAIQNFQNNFQLILKNFKLFRLSCQLDRQTQVNEKVENTQLLQIINLVYLVLICLIKNNY
TNKQTTNLIFKSDKLIKQSELDQILNSQQIVRRINKQIIIYLADINKVKYFLNKTNNKNN
SFQQISYHINKSINIQRIFNNYLNIFQALKIHKKLLKKKQKKDNKQSKQKLIDQFLNKME
VEKGKQGETNQDQEKKNENLVSKQDQSNNQNKWHSLRKYLNNQFPCNNKDLFDSEKEELT
QKFDEQVKNIFNERDLNNEFTSLGRKRSKLQLLYGINNQVKQRFQETMFYLAIEEQYMKL
EPLIAYPFNSNSTLNWQPFWNLVLKMIFKNDLQNTNLQEAVLPETINFLQVIKKIRQKFD
DSSIQEVYDLYKKLRLSNSGQLSLLLVRYFLKISRNTPKELYQQIFQEFTLQLSYDQPIR
NRLVMLTILYNLAKAHPQLDWENQYDQIFTFISRYYIQRMPLGFTYYQPQQKLYYLSIYN
PQTLIMSLLIALIAPETEKEKHEKIWKNIHRLFNLIKQYLHPNYDNTPTIKFLFQQFQQF
VSTFIWTHGEQQKQINNLEKQKAKLERKIKILNAAQKQDEQLVSQQGLPGDEQDELKDQN
IDTELLNEDEGGNMQMEKGMDQFKSQAMDYEGNDNPQMQNIQARVEEDEVDDEDENEDSD
DEQEKFDKFVNEFSEKAQNEQAEEVEKYQKKLQTVIEKLNVKKQFAFDNACKQQFESIIE
ANLINILGINDQSGNILPQICKDLCYFNPSKFIPIILDNIYEAFEKPDMNYSTAISVLTS
IIIPMVDRTNYKQGLYQIPTLMKKVLDIFNTSNFQLSVKMWKLFDQIFQVVPIYNVDDLQ
EAYMEKNPGKSYSDFYQDLNKDEEINMITFYEQLHDVTYNIFQKFLSIFEHIDMPRSKNT
RGFRAAVISVLNFFTSIAFSTSKKLFKQLWSHAFQCITDRQQLHASKFYSYLIHSFTLRD
PQLVLQSMIPYLFDHILIKRENPDLTEIEKQPLYYLLQQQPNKDHILSYQIESINSNSLF
WYLNLLEDTIFFGRQEILKYKTEIETIIFLCFVHTETEFSKKACQLLQKIFHSLITFYPS
EMFIWSENEIEDDLNFKEMYHRYIGQSSKKKFSMKWHEPTAVEVEYSKELFFRIYNPILN
HFNNNHFKNLEPIDVDNNFTQILDATMHAPDDAPRSLKTELQRSIMLLFHLYSSIATRLK
WGIDEQDGIYKKFSSTFCLPEYDNINSEMIDFSENMINFMIKNNLFYDSNVAQVYLSLIL
FILGNDDQTGYINGIKNKLKELKNQNSNPYRSYQGYPRFVEVTSVTTQFNTKVILYTFDT
KLNDKHSKLLKPLLFLILHPYQKISEKSINSYLMMADLLKNKSYYIQSLKTFCSFLQAKL
SKKSNDFFPKVIEECKEKDPKLVPMLSTYQDRTISSLIVLNFVAKKFDQDYAFVVDTLMS
IVESYNIFLSKDLKDKIIDIPLNQLMHLVTKLKKLDIAYNQPIQKLGIYKEKSQVLQEIL
QQDNKERTHQLQGEQKMLQIKALIKQLYDRCLLNLEDPTVFSKEKIFMIIIAMKTANFTD
ANDERFKKILENAINFTNYDNLHSRNIGRAMLFKCIRTLKNQYKKREEKITIEDDYVKDQ
NKPLEELSAYFLFKKEDIEDNFYTNRHQDFILYKKSTTYLEHKKDIIFYQKFSDKEFLNT
FLEHILNDITTHTMAEQSLKPKNIFNTADLIFQQEFVKNFKKKNFFSDGPSFFHMKLLKK
IFGLLGMQFFEVAKVHLEKYKNDYSTLEGSTIMNVLTFSCLLGIFQIEQDATEQEKEETY
KYLMEIVIDRAYQLNLEQFAYFMKYLETVIESISFRESQRILDDIYKSPKLGNQQDPKYQ
RYLYTKLLQLNKFNIKNQEILEGLINELKTVNPLSIQQLPIYNLVHNAVWSYHQISIDFN
FCKKYNIIKDIDQLVEQGRLRKIDSFQAIRINPQINQIYDFILNQLNSEDPEVKKKYYRL
VKVFSSIFKEDHLFKTEIYNSMKSLFPYFIEFKEEDIADAQLVQEFWSNLIFLSIPLYNK
ETVLELLELCYKNFKNTNWRIRQRALLFNQFIAFFNLYRIGDFNYIDPLLELMNDEQKQN
KSIAQKVLSLVIKTLPVEQVGGFVERMQKMAVSEDKNQKIIAVYCLMSVLLSYPHEIKEW
TENAIRTILKNKNISPDTLTLLKEFGAAFLRNALHNKVESKLKLPEDLIIRLEEISRPHN
YFA


>TTHERM_00804710(gene)
ATGGCAATATAAAATTTTTAAAATAATTTTTAATTAATACTAAAAAATTTTAAATTATTT
AGATTAAGTTGTTAGTTAGATAGATAGACTTAAGTAAATGAAAAAGTAGAGAACACTTAA
TTATTACAGATTATAAATTTGGTATATCTGGTTTTAATTTGTTTGATAAAAAATAATTAT
ACAAATAAACAAACAACCAATCTGATCTTTAAATCTGATAAATTGATTAAATAAAGTGAA
TTGGATTAGATATTAAATAGTTAATAGATAGTACGTAGAATCAATAAATAAATAATAATT
TATTTGGCAGATATTAATAAAGTTAAATATTTTTTGAATAAAACAAACAATAAGAATAAC
TCATTTTAGCAAATATCATATCATATCAATAAATCAATCAATATATAGAGAATCTTTAAT
AATTACTTAAATATATTTCAGGCATTAAAAATACACAAAAAATTGTTAAAAAAGAAATAG
AAGAAAGACAACAAACAAAGCAAGCAAAAATTAATAGATCAATTTTTAAATAAAATGGAA
GTAGAAAAGGGTAAATAAGGAGAAACAAATCAGGATTAAGAGAAAAAAAATGAAAATTTA
GTAAGCAAATAGGATTAAAGCAACAACTAAAATAAGTGGCATTCTTTGAGGAAATATCTC
AATAACTAATTTCCTTGCAATAATAAGGATTTATTTGATTCTGAAAAAGAGGAATTAACA
TAGAAGTTTGACGAATAAGTCAAAAATATTTTTAATGAGAGAGATTTAAATAATGAATTT
ACATCTTTAGGCAGAAAGCGTTCTAAACTGCAATTGCTTTATGGCATAAATAATTAAGTA
AAACAGCGCTTTTAAGAAACAATGTTCTATTTGGCTATTGAAGAATAGTATATGAAGTTA
GAACCTCTTATTGCGTATCCTTTCAATAGTAATTCTACACTCAATTGGTAGCCTTTCTGG
AACTTGGTTCTTAAAATGATATTCAAAAACGATCTTTAGAACACAAATCTCCAAGAAGCA
GTTCTTCCAGAAACTATCAACTTCCTCTAAGTCATCAAGAAAATTCGCCAAAAATTTGAT
GATAGTTCTATTTAAGAAGTTTACGACTTGTACAAAAAGCTGGTAAAATAGAAAATTAAT
TTAAAGCATGTTGTATTAGAAGAAATATTTATTATTCTACTAAAGCTTCATCTATTCCTC
ATCTTAATCATATAGCTAGTTTATAAGCATTTGATGTTTCCTAGCATGAAAAATTAACAC
TTATTTAGAATCATAGCAGTTATTTTAAATATTTTTGTTGCGTTTTACAAGATAGATGCA
AAGAATAAAGCTAGATTTTAATTTAAAAATAAACAACAAAAACTTTCTTTTATTAACCAA
TTTTATTTTTTAAAAATAAATAAATTAAAGCGATTATCAAATAGCGGATAACTCTCGTTG
CTTTTAGTGAGATACTTTTTAAAAATATCTAGGAATACTCCTAAAGAATTATATTAGTAA
ATATTCTAAGAGTTCACTCTCTAATTAAGTTACGATTAGCCTATCAGAAACAGATTAGTT
ATGCTCACCATCCTCTATAATTTAGCAAAGTACGTTATTTCTAAAAGCAAACAATTTTTA
ATTTATTTTTCCAATCATTGAGTGAATAAATCTCCATAAGGAGATAACAAAACAAACAAA
CAAAAAAAGAAAAGATCAAATTTTTTTATTTTTTAAATCAATAATAATTAGCTTTGACCA
ATACAATAAAAAAATAAAGAATTAATGAATTAATTTAGCAATATTTTATTAATGAAAACA
ATAAATTTATAAAAAGAGCTCATCCATAGCTAGATTGGGAGAATTAGTATGATTAAATTT
TCACATTTATCTCTAGATACTATATACAAAGAATGCCTTTAGGTTTTACTTACTATTAGC
CTTAGTAAAAATTGTACTATCTTTCTATATACAATCCATAGACTTTGATTATGAGTCTTT
TGATAGCTTTGATAGCACCTGAGACTGAAAAGGAAAAGCATGAAAAAATATGGAAAAATA
TTCATAGACTTTTCAATCTGATAAAGCAATATTTACATCCTAATTACGATAATACTCCGA
CAATTAAATTCCTCTTTTAGCAATTCTAATAATTTGTATCAACTTTCATATGGACTCACG
GCGAGTAGCAAAAATAAATCAATAACTTAGAGAAATAAAAGGCCAAATTAGAAAGAAAGA
TTAAGATTTTAAATGCTGCTTAAAAGTAAGACGAGTAGCTAGTTTCTTAGCAAGGACTAC
CTGGAGATGAGCAAGATGAATTGAAAGATCAAAATATAGATACTGAGTTGTTAAATGAAG
ATGAAGGTGGAAACATGTAAATGGAAAAGGGTATGGACTAGTTTAAGTCATAGGCTATGG
ATTACGAAGGAAATGATAATCCTCAAATGCAAAATATTCAAGCTAGAGTTGAAGAGGATG
AAGTAGATGATGAAGATGAAAACGAAGATTCAGATGATGAGCAAGAAAAATTCGATAAGT
TTGTAAACGAGTTCTCTGAAAAAGCTTAAAATGAGCAAGCAGAAGAAGTAGAAAAATATC
AAAAAAAGCTACAAACAGTTATTGAAAAGTTGAAGTAAAAAAATTAAAAAGTAAATTTAG
GCAAAATAGATTTGAACAAATTATTTAAAATTAAAATAGTGTAAAAAAGTAATTTGCCTT
CGATAATGCTTGCAAATAGTAGTTTGAATCTATTATTGAAGCTAATTTAATTAACATATT
GGGAATAAACGACCAGAGTGGCAACATTCTCCCTTAAATTTGCAAAGATTTGTGTTATTT
TAATCCTAGCAAATTCATTCCAATCATCTTGGACAATATTTATGAGGCTTTCGAAAAACC
TGATATGAATTACTCAACTGCAATCAGTGTTTTAACTTCAATAATTATCCCTATGGTAGA
CAGAACTAACTACAAGTAAGGTCTCTATCAAATCCCAACTCTAATGAAGAAAGTCCTTGA
TATTTTCAACACCAGCAATTTCTAGTTATCAGTAAAAATGTGGAAGTAATAAAACAAATT
TAATTTAATTTATTGGGTAATTTATTCATTAATGAAATTTTAATAGGTTATTCGATTAGA
TTTTCCAAGTTGTTCCTATTTACAACGTAGATGATTTGCAAGAAGCCTACATGGAAAAAA
ACCCTGGAAAATCATATAGCGATTTCTATCAAGATTTAAACAAAGTAAACATAAAAAACA
TTATAATCTAAACAAAATCATATAATAAATTATTAAATAAATCAAAGGATGAAGAAATAA
ACATGATAACATTTTATGAGTAGCTCCATGATGTTACCTATAACATATTCTAAAAGTTCT
TAAGCATCTTTGAGCATATTGACATGCCCAGATCTAAAAATACTAGAGGATTTAGAGCAG
CTGTGATATCTGTTCTAAATTTCTTCACATCAATAGCGTTTTCAACATCTAAAAAGCTAT
TTAAGCAAGTAATTCATTCGATTTTCACAAATTATGCTAAATCCTTTTTGCTTTTTCAAA
ACCTAATTTGAAATGAATATTTTTAATAAATAATTCTTAAAATGTTATTTTTCAAATTAA
AATTTTTAATAAAATTTCTTAATTTTGAAGAAATTTTTAAATTGAGTTTTTAAAAAATTA
AAACATTTTTTATATAAATTAATATTTTTTTATCTTAAAAATTAATTAAATAAAGTTGTG
GTCTCATGCATTCTAATGCATCACAGATAGATAACAGCTTCATGCATCTAAATTTTATAG
CTACTTAATACACTCATTCACTTTACGTGATCCTTAATTAGTTTTATAAAGCATGATTCC
TTACTTATTTGATCACATCTTGATAAAGAGAGAAAATCCTGATTTGACAGAAATAGAAAA
GCAGCCTCTTTACTATTTATTATAGCAATAGCCAAACAAGGACCATATTCTCTCTTATCA
AATCGAGAGTATAAACTCTAATTCACTATTCTGGTATCTAAACTTGCTTGAAGATACCAT
ATTCTTTGGCAGATAAGAGATCTTAAAATACAAAACAGAAATCGAAACAATTATTTTCCT
TTGCTTTGTTCATACAGAAACCGAATTTTCTAAAAAGGCTTGCCAGTTGCTTTAAAAAAT
ATTCCATTCTCTTATTACTTTTTACCCTTCAGGTAATTTTCAATAATAAATTTTTCCAGA
TATAATTTTTTTTGTCATAAAATGCTAATTTTCTTACTAATAAAATCGTTAATTATTTAG
AAATGTTTATTTGGAGCGAAAATGAAATTGAAGATGATCTTAATTTTAAGGAAATGTACC
ATAGATACATTGGCTAGAGCAGTAAGAAGAAATTCAGTATGAAATGGCACGAACCTACTG
CTGTTGAGGTTGAATACTCAAAGGAGTTATTCTTTAGAATATATAATCCTATTCTAAATC
ATTTCAATAACAATCATTTCAAGAATTTAGAACCTATTGATGTTGACAATAATTTCACAT
AGATACTCGACGCAACTATGCATGCTCCAGATGATGCTCCCAGAAGTCTTAAAACAGAAT
TATAGAGGTAAATATAATTAATTATCTCATTAAAACATTTTTAGTTAACAAAAATTTTAA
TAAAAGGTCTATCATGTTGCTTTTCCATCTTTATAGCTCAATAGCTACAAGACTAAAATG
GGGAATTGATGAATAAGATGGAATATACAAAAAATTTAGTTCTACATTCTGTCTTCCTGA
GTATGATAATATAAATAGTGAAATGATAGATTTTAGTGAAAATATGATCAATTTCATGAT
AAAAAATAATCTATTTTACGACAGCAATGTTGCTTAAGTTTATCTATCTCTGATATTATT
TATTTTAGGAAATGATGACTAAACTGGTTACATTAATGGTATCAAAAATAAGCTCAAAGA
ATTAAAGAATTAAAATTCAAATCCTTATAGATCATATCAAGGATATCCAAGATTTGTAGA
AGTTACTTCAGTTACAACACAATTCAACACTAAAGTTATTTTATATACTTTTGACACTAA
ATTGAATGACAAACATTCCAAATTGCTTAAGCCACTTCTATTTTTGATACTCCACCCTTA
CTAAAAGGTAATCTTTTATATTGATTTTATCTAATACTCATTTACTTTTATCAAATAGAT
TAGTGAAAAATCTATCAATAGCTATTTGATGATGGCTGATCTGCTCAAAAATAAAAGTTA
TTATATTCAAAGCTTGAAAACATTCTGCTCGTAATAAAGATTTATTTTAATAAAATTAAT
TAATTTTGAATTATTTAGATTCTTACAGGCCAAATTGAGCAAAAAGAGCAATGATTTCTT
CCCTAAAGTAATTGAAGAATGCAAAGAAAAGGATCCAAAGCTAGTTCCTATGCTTAGCAC
ATATTAGGACAGAACTATTTCTTCGTTAATAGTTTTGAATTTTGTTGCAAAGAAATTCGA
TTAAGATTATGCTTTCGTAGTGGATACTTTGATGTCAATTGTAGAATCTTACAATATCTT
TTTATCTAAAGACTTAAAAGATAAGATAATTGATATTCCATTAAATTAACTAATGCACTT
AGTAACTAAACTCAAAAAGTTGGATATCGCTTACAATTAACCAATTTAAAAGCTGGGAAT
TTACAAGGAAAAAAGCTAGGTTCTCTAGGAAATTCTATAGCAAGACAGTAATTTTTATGA
TTTTTTTTATTTGTGGATAAATAAAAATAATTTTAATAAAAAATTAGATAAAGAAAGAAC
TCACTAATTATAAGGAGAGCAAAAGATGCTTTAAATAAAGGCACTGATTAAGTAGCTCTA
TGATAGATGCTTGTTAAATCTAGAAGACCCTACTGTCTTCTCCAAAGAAAAGATTTTTAT
GATCATAATCGCAATGAAAACTGCAAACTTTACAGATGCCAACGACGAAAGATTTAAAAA
AATATTAGAAAATGCAATTAATTTCACTAATTATGACAATCTTCATTCTCGTAATATAGG
CAGAGCAATGCTTTTTAAGTGCATTCGTACACTCAAAAACCAGTACAAAAAAAGGGAAGA
AAAAATTACAATCGAAGACGATTATGTTAAAGATTAAAATAAGCCTCTTGAAGAATTAAG
TGCATATTTCTTGTTTAAAAAGGAAGATATTGAAGATAATTTCTATACAAATAGACATCA
AGACTTTATCCTCTACAAAAAATCTACAACGTAAAATATTAACAAAATTTTGAAAAATAT
CTTTTTCATCCAGCACTTAATTTAATATTGAAAATAATTTTATGAATATAAATAAAAAAT
TTTGTTAAATAATATAAAATTTATTTATATCAACAAATAAACAAAAATATTAAAATAAAT
TTAAAGAAAAATTTTTAGAAATTTACTTTAAAAAAAAACAAACAAACAAAAAAAAATAAT
GTTGATTTGGCTCATTCTAATTTGCGCGAATTTGTTTAATACCTAGCTTTTAAACTTATT
TTTAAAATATTAGAATTGAAAAAAAACATTTAATTTTTACAATCTTAAAATTCATAAGAA
AATTTCATTAATTATTACAATATCAAATTTAAATAAAAATTTAATTTTAGAACTAAAATT
AAAACAAATGTTTAATTATTACAATATCAAAACCAAATAAAAACTTAATTTTAGAACTAG
AAATTTAAAATTAAAATAAATATTAAATTATTAATAAATGGAAACCAAATAAACTCTTTA
TTACAGAATTAGAAATTTAAAATAATAATGAAATATAGATTTAATAAAAATATAATAATT
GATAATTTCAATTATTATTCAAAAAAATAAAGTCTTTAATAACAATTTTATATGCAAAAA
AAATTTAATTAAATTTGATTACTTATTTAATTTTAATTAATATTAAAATAGATATTTAGA
ACATAAGAAGGATATTATTTTTTACTAAAAATTTTCTGATAAAGAATTTTTGAATACCTT
CCTTGAGCATATTCTGAATGATATTACGACACATACTATGGCTGAATAATCTCTAAAGCC
TAAAAATATTTTCAACACTGCAGATTTGATATTCTAATAAGAATTTGTGAAGGTAAATTT
GATTTCTTTGTTTGCTAAAAATATATTTTAATAATTATTTAATTATTTAACTTTAGAATT
TCAAGAAAAAGAATTTCTTTAGCGATGGGCCATCATTTTTCCATATGAAACTTCTTAAAA
AGATATTTGGTTTACTTGGTATGCAATTTTTCGAAGTTGCCAAGGTTCATTTAGAGAAAT
ATAAGAATGACTACTCAACTCTTGAAGGATCTACTATCATGAATGTACTCACTTTCAGTT
GTTTACTAGGTATTTTCTAAATAGAATAAGACGCTACTGAATAAGAGAAAGAAGAGACTT
ATAAGTATTTAATGGAGATAGTTATCGACAGAGCATACTAACTTAACTTAGAATAATTTG
CTTATTTCATGAAATACTTAGAGACAGTGATTGAAAGTATATCTTTTAGAGAATCTTAGA
GAATTCTTGATGACATCTATAAATCTCCTAAACTAGGTAATTAGTAGGATCCTAAGTACT
AACGTTATCTTTATACAAAGCTCCTCTAACTAAATAAATTCAACATAAAAAATTAAGAAA
TCTTGGAAGGGTTAATTAATGAATTAAAAACTGTTAATCCTTTGTCTATTCAATAACTTC
CTATATACAATCTAGTTCACAACGCTGTTTGGTCGTAATTTTAAAATACATTTAAAAATT
CAAAGAAAAAATTAAATATTTTTTATACATAATAAATATAGTTATCATTAGATTTCGATT
GACTTTAACTTCTGTAAAAAGTACAACATAATTAAAGATATTGACTAATTAGTAGAACAA
GGAAGGTTGAGAAAAATTGACTCATTCCAAGCTATTAGGATTAATCCTCAAATAAATTAA
ATTTATGATTTCATTCTAAACCAATTAAACTCAGAAGATCCTGAGGTGAAGAAGAAATAT
TACCGTCTTGTAAAAGTCTTTTCATCGATTTTCAAAGAAGATCATCTCTTCAAAACAGAA
ATCTATAATTCAATGAAAAGCCTTTTCCCTTACTTCATAGAATTCAAAGTAATAATATTA
AAAGCTCATTAAAAAAAATTATTTTAATGTCTTTTTATTCTTTTATTTAGGAAGAAGATA
TTGCTGATGCCTAACTTGTTTAAGAATTTTGGTCTAATTTGATCTTCCTATCGATTCCAC
TTTATAACAAAGAAACAGTATTAGAATTGCTAGAATTATGCTACAAAAACTTTAAAAACA
CTAACTGGAGAATTCGTTAGAGAGCTCTTCTATTCAATCAGGTAATTATTTATTTTCATC
CCTCTTGATAATATTTAATCTTAAATTAATATTCAACAGTTTATTGCCTTTTTCAACTTG
TATAGAATTGGCGATTTTAACTATATTGACCCTCTTTTGGAACTTATGAACGACGAGCAA
AAGCAGAACAAATCTATTGCTTAAAAGGTACTTTCCTTAGTTATCAAAACTCTACCTGTA
GAGTAAGTAGGAGGATTTGTAGAAAGAATGTAAAAAATGGCAGTAAGCGAAGACAAGAAC
TAAAAAATCATAGCAGTTTATTGTCTAATGAGTGTATTACTTTCTTATCCACATGAAATT
AAGGAATGGACTGAAAATGCTATTAGGACAATTCTTAAAAATAAAAACATATCACCAGAT
ACATTGACTCTTCTCAAAGAATTTGGAGCTGCTTTCTTAAGAAATGCTTTACACAACAAA
GTAGAAAGTAAGCTAAAACTACCTGAAGACTTAATAATTAGACTTGAAGAAATATCTAGA
CCACATAACTACTTTGCTTGA