Identifiers and Description

Gene Model Identifier

TTHERM_00137780

Standard Name

PACF1 (Proteasome Activator Complex subunit Four)

Aliases

PreTt24404 | 10.m00453 | 3698.m00171

Description

regulator of 20S proteasome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00137780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05841.19.997093137033517e-262hypothetical protein (1958 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00137780(coding)
ATGAATAGCGGCAAAATTTTAAGACAAAAGTTTTATCATAACAGACTTCCCTTAGGGTTG
GATTAGAATTTCGATAGTGAAAGAGAGTTCTTTTGGTCTGAGATTATTCACACAATTACA
TCCAAAGATGTAGTCAATCAAGCAGGTATTGCAGGTAGTAACATCAAATAGTTGATTGTT
AAGTTTAAAAATGTTTATGGACTCAAACTCGATGAATAACAGTTATTAATAAGTCTATTA
CTTGACATGTTATTCACTAGAAAAAATGTTAGAACTGATTCCAAAGTTCTTCTCTTTAAT
TTCTTGAATGAAATGCTTTCAACTAGACCCGAATTTGATGATTTTAAACTTGATTGGAAA
TCATTTTACGAGTTTTATCTTTAAGAATTCCATAACAACGAAGAAAAGCCTTTCAGAAAT
GAATAAAACAATATCTCTTTATTTTCGGAGTTTATCGTTTTAGTAAAGAGATGCAAGTAG
TATTTTGACGTGTCTTCTATAAAAGAAGTTTATGAGATATTTAAGTAGAATTATACTCCA
TCAAAGGCAGATCATCATATGAATTTGTTAACTCTCTTTTTGAAAATTGACTAAGATGCT
GGAAAAGAAGTATATGAAGAACTCCTATAAGACTTTGTTTAATATTTGAATTTCTCATAT
TGCTCTAGAAATACTTTGACGCTCTACAATATCATGAAAATACTTCGTGAATTTAAGAGT
CTTAATTGGGAGAAATATTACGATGAAATTTTTACTTCTATTTTTAGAAATCTAAATAAT
TTGTTAATCCTTGATACTGCTACTGCTGAAGAAAATGTTATTAACACACTTCTTCCTGAA
GAGCCTATTGGTGTAAAATCAATTATGAAACAAATCCCTGATTTTATGGTTCATCTTCTT
CTTCCTTCTACCCACAAAAACTACGAAATAGTTTGGCAATATATTGAAAGAGTTTTCTTG
CTTATAGACAGAGTATTCAATCCTAATAACAAGTCAGAACAATGTGATACTTTATTAAAG
TTATTCAAAGGTTTTGTTAGAAAGTTCATTATTAGATATGATATGGAATAAAAGGATAAG
TATAATTTAGATGATAAATTGAGCACAGAAGATGACGATTCAGATATTTTTGATTTAGAA
TACAATATTAGCGATTATCACATTCCTGAATACTTGCAGGAAAAGAATTAAAATAAGAGT
ATAGCTAAAAAGCAATTCGAACCAGAATTCATTCTAGATGAAACTTGCAAAGAAAGATTT
TTGGGAATTTTGGATAGATTCTTAAAAAAATTAGTATATATGGAAGATGGTTCTCATAGT
TCTTGCAAAATTTTGCATTGGTTGTGCTATTTTGAACCTCAAAGATATGCTATTCCAGTT
ATTGAGCATTGTCTTCAAAGCTTTTCTTACATGGAAGAATTAAATTACGCAACTATTAAA
AACATTGTGCTTTTTATTATTCCAGTTCTTTGTGATCGCAAGCTTTGTCCAACAGGCTTG
AAATATATTCCTTAATTCCTGAAGACTTCTTTCAAATTATTTGAGAAATAAGGAGTCAAG
GATAATTTAGATCTTGTTGAAGCTTATTCTAAGATTTTCATGCTTCTCCCTATCGAAAGA
TATTAAGACCTCTTCAAAAGCTACAAGGCAGAAAATCCTGAAAAGTACGAAAAAGACTTT
TAAGAGTTAATTAACGATCATAATTTTGATGCTATAGAATTTATTTAATAGTTAGAAATT
TTTGCAATAAAATTCTTCAAATTGATAGTAGAGAATATCGGCACACTTGATATGGCTGAC
AGTGAGAGTTGTACTTTAATCATTGATTTCAATAACATTTTCTGGACTTTCATTGTAAAT
AGCTCTCACTCATTGCGTTTACAGTATATTAATATCTTATTTGCAAGACTTGAAGACAAT
ATTATCCCTGAAGGACAATAAGCCATAGCATACCTTTTAGATTGTTTGAGTTTGGTTGAA
CCAGAAGTTTTACTGTAAAAGACTATTGAACTTTTAGAAAAGAAATTAATTAAGAAAAGA
ACAGATCCATCCACAATTGAAAGCATGAAGAGCAATGTAATGTGGTATTTCTTGGAAAAG
AACGAAAACAAAGATAAAATTTTAGAAAAAGAATTTGCTATTTTTACTGATACATCAATC
AAATACTACGTTAGCATCCTAGAAAACGCAATGAGCTATTCTAGATCATATATTATCAAA
CACTTAGATTTCATAGAAACTATTGCATTCCTTTGTTTCTTCTAAGACGACTTAAGTGTT
TTTGAAAAATCATGTGACATTATTCACACTGTTATTCTGACTCTAGGATATATTTATCCT
ACTGATGTTAGCTATTTAAATAAATCAGAACGTCCCACAGATAATACTAAATATCAATAT
CTTCATAACTTAGGCAAAACAGATTTAAACAAATTTTAACTTGAATGGTACAACCCTTCA
GAATAAGAAAAGGCCATCATTATGAAATGGTTGAATAGAACCCTCTATGTAGTTATTAGC
TATTTCTAAGATAACTACTTTAGCAAGCCACAATACCCTATTTTAGACTATGAAAAAGAC
TATGCACTCATTATCCATGAAATGCTTTTCGATGAATCTACTGATTTATCAATTTCTAAG
ACTTAAAAAGATTTTTATAAAGTGCTCTACGTAGCTCTCGCTTCATTCTCTGGTATCAAT
GTCAGAATTCCTTTCATAAAACCAGATAATCTTGATCAATGCAACGAAAGGGTAAAGCAA
TACCATAAATTCTATAAAAGCTTTGAAAGCAAATTCATGTTTGAAGAGCTCTCAAATTGC
CGTAACGAATTAACTGATTTATGCACCAAGTTACCTTCCTTGTTCCATCACACTAAGACA
ATATAAGATGCTTCTCTTATTGAATTATATCAATACATAAGTCGTGAGTGCTTTGGAGAA
TCTTATTTAATTGAAGAAATTAAAAGATCTAATGAAATGATTGATGGATTATGTGTTTTG
AATGATTTCCATAGACCAAATCTATTCAATAATAGATTCAGTTTAGCCAGTGAGTGTATC
ACCTACTTAAATGAAAAGATAGATATGTTCTTCTTCTTAAATCCTTATTTAGGCAAATAG
AAACTTTAATTATTTAACAGTTTCTTTATTCTGTCATTCCACCCTACTTACTTATTCAGA
ATGTCAATTAGATTTGACCATGATTTAAACTTTTCTCTTACTGAAGATAACGAGTACGAG
TCTATGCATAAGAAGGCCTTCTAAATCATGAACAACTATATCTTTAAAGAAAATATTTTC
TAAAAGGAAGCTACTCCCACTATAGAAAAAGTTTAAGAACTCTTGCTAACTAATCTTCGT
ATTGAGTCATTACAAAGATTCCCATGCTGCGCAGCTAATCCCGACTCTTTCTATTATATT
TTCAATAGTGTAGAAATATTCGAAATGTTAGATAAAAAAATTTGGTAGTAGAAAGTTATC
GAATAAATAATGAAAACACTTACCGCCAACTATGAAGATGCTTATTTGTTTTCATAGCTT
AGACCAAATGACATTAAAAAATGCACAATTCCTCCTATTATTAAAAGCAATCCTTAATAT
TACGAGAGTTTGAAGACAATTAAAATTGATAGAGACAGCATTTCACTTGAAAAAGCTAAA
GCAGTTAGGGAAGCTTTCTTAGAAATTATAAATAAATCAAACAATAAAATGGATGATCCA
AAGACTCATTGGAAAACAAAGGTTCTGTGTGGACTATTTGTTGTATACTTTTTAAATATC
TTCGATGATTTGAACCACCCTTACATAGCTAGATTTGCTTAAATTTCTATTAATTTTGCT
ACAAGCAAGACTGACATTCATCTAGCTTAATATGGAAGATCACTTCTTTTCAGATTAATT
AACATAAATAAGAGAAGAGTTGTTAAAAAAAATTATGAGCCTATGCCTGGCTTCTTTGGT
CCTAGCATGGAGGTCGAAGATTCTAATGATGGTGAGTATACCTTAGAGGAATTCTTTTAA
TATCATTTCTTAAAAAGAAAAGATTTACAATCGTACTTAATTAAATCAAGAGAAATCGGT
ACTTACTATGACTATGCTCCCCTCTATAATAAATCAGGCTACTAAATGAAAGAAAGCGAT
GGCATCTACTCCGAAACAATTATAAAAATTCTCTTAAATGAAAACTTCTTTAATGAATTT
ATTGAAACAATATTTGAAGCAAAAGAAATTTACTCAAGCGATAGTGATGAATAAGACCAA
GAAAACCAACAAATAGATTTAAGCCAAGGAGAAGTCTTCGATTAAATCTAAATTTTATTT
AATTTCACTTTCGATTCAGATAAAAAGAAATAAACCTTATTCAACATTAACCTTAATTTT
AATTTATTCGAATTCTACGCACGTCTCTTTAAGAAAATATTCTAGGCAGTTGGAAAAAGA
TTCTTTGATGCTACTCATAAAAAAATAGAATCTCTTGCAGATGACTTTAACAATTTACCA
AGATAAAGAGTGATTTCTATTTATGTTTGGTCTATCTTAAAATGGATTTAACGTCTCTCT
CGTGAAGAAAGAAAGCCTTATATGGATTTCTGTGTTAATCTTACTTAAGAATGTATTGTT
AATTGCTCATAAGAACTTTTTAGAGACTGGTGCTTAAGTATATCACTTGCCTCTAAGAAT
AATTCATTTGATGTCATAGAAGAATTTGCTTCAAGAATATTGGAAAAATTAAAACACTAA
AAGGGTATAGGCAAAAGATTTAGATATCATAAACTTCTTAAAACTGTTTTAACATTAAAT
CAAACATGGGCTAGAAAGTATTGTTTAGAAGGAATGAAGCTCATCATGGATGCTGATGTC
GAAGATACTAAAGAAAGTGATGAAAATTGCGAATTATTTGCCGAAATTCTTTGCTCATGC
ATCATAAGTAGAGTAAATGTTAAAAAACTCAAGCAAGAAAAATGGATTAAAGAAGATCTT
TAACAATTAATTGATGAGAAGAAACTTATCGTTTAAGATGACTATACTGCTTTCGAAAAT
AATAAATTAATTACTCAGTTTATTGAGCACTTATTTAACAAGCTCAATAATGTAAAGAAA
GAGTCAAAGAAAAAGCTCTACAGTCACATGACTTTCAAAGTACTTGATAGCATTTCTGTC
AAACGTTAAAACGATCTCTTCTGGTCTTACTTCCGCCCATTCTTCACATATATTATTGAC
AACAAGCCTGAGAATATAAACGAGATAGAAATATTGAAGGTTATGTCATGTAATGAGTAT
CCTGCTAATATAAGAAAGGATATCAAGAGAATTTTAGCTGAAAAAATTGAAAGTGAAAAT
TGGGTCAGTCGCCAAAAAGTAATTCTCTTCTTAAAGAACTTCTTATACTTTGAAGAATAT
TAAGAAAACTAAGTTTAAGTTGATAGTTTGATAATTAGAGGCTTAACTGATAAGAATAAT
TCTGTTTCCTTGTTAGCTGTTGATTGCTTAAGTGAAATTCTCAAGCTTGCCACTACAGAT
GAATAAAATACTATCTTCTAAAAGTACAAATCTTAGTCTCAATCTCTTCTTCCTAAAGAC
AAAAACTCTGAAGAATACAAATAACTTACTGATTAAAAATAAATTGCTGTTTAAGTTTTA
ATGTCTCTCCTTTTGGCCTTCTAAGAGGATATCCTCCCCTGGACCGAGGAAGCCTTAAGA
GAAGTTATTAACTCTAAAACATTAAATGCAAACATGAGAAAAAAAGTAAAGGAATTTGTT
GGGTAATATTGGAGAGAATAAGATGAAGTTATAACATTTAATTCTTTATCTTTATCCGAA
AAGATAAAGAAACAAATCAGAGAAATCGCTAACCCATACGATTATTTTGCATGA


>TTHERM_00137780(protein)
MNSGKILRQKFYHNRLPLGLDQNFDSEREFFWSEIIHTITSKDVVNQAGIAGSNIKQLIV
KFKNVYGLKLDEQQLLISLLLDMLFTRKNVRTDSKVLLFNFLNEMLSTRPEFDDFKLDWK
SFYEFYLQEFHNNEEKPFRNEQNNISLFSEFIVLVKRCKQYFDVSSIKEVYEIFKQNYTP
SKADHHMNLLTLFLKIDQDAGKEVYEELLQDFVQYLNFSYCSRNTLTLYNIMKILREFKS
LNWEKYYDEIFTSIFRNLNNLLILDTATAEENVINTLLPEEPIGVKSIMKQIPDFMVHLL
LPSTHKNYEIVWQYIERVFLLIDRVFNPNNKSEQCDTLLKLFKGFVRKFIIRYDMEQKDK
YNLDDKLSTEDDDSDIFDLEYNISDYHIPEYLQEKNQNKSIAKKQFEPEFILDETCKERF
LGILDRFLKKLVYMEDGSHSSCKILHWLCYFEPQRYAIPVIEHCLQSFSYMEELNYATIK
NIVLFIIPVLCDRKLCPTGLKYIPQFLKTSFKLFEKQGVKDNLDLVEAYSKIFMLLPIER
YQDLFKSYKAENPEKYEKDFQELINDHNFDAIEFIQQLEIFAIKFFKLIVENIGTLDMAD
SESCTLIIDFNNIFWTFIVNSSHSLRLQYINILFARLEDNIIPEGQQAIAYLLDCLSLVE
PEVLLQKTIELLEKKLIKKRTDPSTIESMKSNVMWYFLEKNENKDKILEKEFAIFTDTSI
KYYVSILENAMSYSRSYIIKHLDFIETIAFLCFFQDDLSVFEKSCDIIHTVILTLGYIYP
TDVSYLNKSERPTDNTKYQYLHNLGKTDLNKFQLEWYNPSEQEKAIIMKWLNRTLYVVIS
YFQDNYFSKPQYPILDYEKDYALIIHEMLFDESTDLSISKTQKDFYKVLYVALASFSGIN
VRIPFIKPDNLDQCNERVKQYHKFYKSFESKFMFEELSNCRNELTDLCTKLPSLFHHTKT
IQDASLIELYQYISRECFGESYLIEEIKRSNEMIDGLCVLNDFHRPNLFNNRFSLASECI
TYLNEKIDMFFFLNPYLGKQKLQLFNSFFILSFHPTYLFRMSIRFDHDLNFSLTEDNEYE
SMHKKAFQIMNNYIFKENIFQKEATPTIEKVQELLLTNLRIESLQRFPCCAANPDSFYYI
FNSVEIFEMLDKKIWQQKVIEQIMKTLTANYEDAYLFSQLRPNDIKKCTIPPIIKSNPQY
YESLKTIKIDRDSISLEKAKAVREAFLEIINKSNNKMDDPKTHWKTKVLCGLFVVYFLNI
FDDLNHPYIARFAQISINFATSKTDIHLAQYGRSLLFRLININKRRVVKKNYEPMPGFFG
PSMEVEDSNDGEYTLEEFFQYHFLKRKDLQSYLIKSREIGTYYDYAPLYNKSGYQMKESD
GIYSETIIKILLNENFFNEFIETIFEAKEIYSSDSDEQDQENQQIDLSQGEVFDQIQILF
NFTFDSDKKKQTLFNINLNFNLFEFYARLFKKIFQAVGKRFFDATHKKIESLADDFNNLP
RQRVISIYVWSILKWIQRLSREERKPYMDFCVNLTQECIVNCSQELFRDWCLSISLASKN
NSFDVIEEFASRILEKLKHQKGIGKRFRYHKLLKTVLTLNQTWARKYCLEGMKLIMDADV
EDTKESDENCELFAEILCSCIISRVNVKKLKQEKWIKEDLQQLIDEKKLIVQDDYTAFEN
NKLITQFIEHLFNKLNNVKKESKKKLYSHMTFKVLDSISVKRQNDLFWSYFRPFFTYIID
NKPENINEIEILKVMSCNEYPANIRKDIKRILAEKIESENWVSRQKVILFLKNFLYFEEY
QENQVQVDSLIIRGLTDKNNSVSLLAVDCLSEILKLATTDEQNTIFQKYKSQSQSLLPKD
KNSEEYKQLTDQKQIAVQVLMSLLLAFQEDILPWTEEALREVINSKTLNANMRKKVKEFV
GQYWREQDEVITFNSLSLSEKIKKQIREIANPYDYFA


>TTHERM_00137780(gene)
ATGAATAGCGGCAAAATTTTAAGACAAAAGTTTTATCATAACAGACTTCCCTTAGGGTTG
GATTAGAATTTCGATAGTGAAAGAGAGTTCTTTTGGTCTGAGATTATTCACACAATTACA
TCCAAAGTACTCCATTTTTTATTTTCAAGCTTTTCAATATAAATACATTAACTCTTCGAA
ATATAAACTTCTATTATTTGAGCATTTGGCTCCTCAATTAGATTAATTTAAGTTCTTATT
CAATTTATTAACAAAAGGATGTAGTCAATCAAGCAGGTATTGCAGGTAGTAACATCAAAT
AGTTGATTGTTAAGTTTAAAAATGTTTATGGACTCAAACTCGATGAATAACAGTTATTAA
TAAGTCTATTACTTGACATGTTATTCACTAGAAAAAATGTTAGAACTGATTCCAAAGTTC
TTCTCTTTAATTTCTTGAATGAAATGCTTTCAACTAGACCCGAATTTGATGATTTTAAAC
TTGATTGGAAATCATTTTACGAGTTTTATCTTTAAGAATTCCATAACAACGAAGAAAAGC
CTTTCAGAAATGAATAAAACAATATCTCTTTATTTTCGGAGTTTATCGTTTTAGTAAAGA
GATGCAAGTAGTATTTTGACGTGTCTTCTATAAAAGAAGTAAATATTTTCATTTTGATTT
GTTCTTTCCTATAATTTAATGCTATTTTTAAGATGAATATCTATGTTTAGCTTAAGGCTT
TAACTTTTAGCAAAGTGTTTATTAGAATTTTTAAATTGAGGTTATCATATTTAACTTTGA
TTCAACATATAAAAAATAAAGATACGCTACTTGTTGGTTTATTTTAATTGTTTAGAATGA
ATGCTTTTAAATTAAGCATAAATAATTCAGCTCATTTCAATAATTTGTTTCCCCAAATAA
ATTTTTATTTATTTATTTATTGATTTTCAAATTCTCAGTTTTGATTATTAAAAATATAAT
ATCTTTTTATGTGTCTAGGTTTATGAGATATTTAAGTAGAATTATACTCCATCAAAGGCA
GATCATCATATGAATTTGTTAACTCTCTTTTTGAAAATTGACTAAGATGCTGGAAAAGAA
GTATATGAAGAACTCCTATAAGACTTTGTTTAATATTTGAATTTCTCATATTGCTCTAGA
AATACTTTGACGCTCTACAATATCATGAAAATACTTCGGTAGAATTATTGCCTTATTTCA
AAAATTTATTTATTTTTTTTATAAAAGTGAATTTAAGAGTCTTAATTGGGAGAAATATTA
CGATGAAATTTTTACTTCTATTTTTAGAAATCTAAATAATTTGTTAATCCTTGATACTGC
TACTGCTGAAGAAAATGTTATTAACACACTTCTTCCTGAAGAGCCTATTGGTGTAAAATC
AATTATGAAACAAATCCCTGATTTTATGGTTCATCTTCTTCTTCCTTCTACCCACAAAAA
CTACGAAATAGGTAAATTTATTTATTCAAATTTTTAATTTAGAATTTAAATTAATTACTC
AAAAAATATCAATCAATAGTTTGGCAATATATTGAAAGAGTTTTCTTGCTTATAGACAGA
GTATTCAATCCTAATAACAAGTCAGAACAATGTGATACTTTATTAAAGTTATTCAAAGGT
TTTGTTAGAAAGTTCATTATTAGATATGATATGGAATAAAAGGATAAGTATAATTTAGAT
GATAAATTGAGCACAGAAGATGACGATTCAGATATTTTTGATTTAGAATACAATATTAGC
GATTATCACATTCCTGAATACTTGCAGGAAAAGAATTAAAATAAGAGTATAGCTAAAAAG
CAATTCGAACCAGGTATTTATTTTCTTTATATTAACTTCTTAATAAAGCTATTTTTTTTT
TTTGGTTAGAATTCATTCTAGATGAAACTTGCAAAGAAAGATTTTTGGGAATTTTGGATA
GATTCTTAAAAAAATTAGTATATATGGAAGATGGTTCTCATAGTTCTTGCAAAATTTTGC
ATTGGTTGTGCTATTTTGAACCTCAAAGATATGCTATTCCAGTTATTGAGCATTGTCTTC
AAAGCTTTTCTTACATGGAAGAATTAAATTACGCAACTATTAAAAACATTGTGCTTTTTA
TTATTCCAGTTCTTTGTGATCGCAAGCTTTGTCCAACAGGCTTGAAATATATTCCTTAAT
TCCTGAAGACTTCTTTCAAATTATTTGAGAAATAAGGAGTCAAGGATAATTTAGATCTTG
TTGAGTAAACTTATTGACTCAAAAATATAATTTTTTTAACTTTTACTTTTTTAATCATAG
AGCTTATTCTAAGATTTTCATGCTTCTCCCTATCGAAAGATATTAAGACCTCTTCAAAAG
CTACAAGGCAGAAAATCCTGAAAAGTACGAAAAAGACTTTTAAGAGTTAATTAACGATCA
TAATTTTGATGCTATAGAATTTATTTAATAGTTAGAAATTTTTGCAATAAAATTCTTCAA
ATTGATAGTAGAGAATATCGGCACACTTGATATGGCTGACAGTGAGAGTTGTACTTTAAT
CATTGATTTCAATAACATTTTCTGGACTTTCATTGTAAATAGCTCTCACTCATTGCGTTT
ACAGTATATTAATATCTTATTTGCAAGACTTGAAGACAATATTATCCCTGAAGGACAATA
AGGTAATGTTTATTTTAAATTCATGAACAAAATATAAATAAAATAATTTTTTATTTAGCC
ATAGCATACCTTTTAGATTGTTTGAGTTTGGTTGAACCAGAAGTTTTACTGTAAAAGACT
ATTGAACTTTTAGAAAAGAAATTAATTAAGAAAAGAACAGATCCATCCACAATTGAAAGC
ATGAAGAGCAATGTAATGTGGTATTTCTTGGAAAAGAACGAAAACAAAGATAAAATTTTA
GAAAAAGAATTTGCTATTTTTACTGATACATCAATCAAATACTACGTTAGCATCCTAGAA
AACGCAATGAGCTATTCTAGATCATATATTATCAAACACTTAGATTTCATAGAAACTATT
GCATTCCTTTGTTTCTTCTAAGACGACTTAAGTGTTTTTGAAAAATCATGTGACATTATT
CACACTGTTATTCTGACTCTAGGATATATTTATCCTACTGATGTTAGCTATTTAAATAAA
TCAGAACGTCCCACAGATAATACTAAATATCAATATCTTCATAACTTAGGCAAAACAGAT
TTAAACAAATTTTAACTTGAATGGTACAACCCTTCAGAATAAGAAAAGGCCATCATTATG
AAATGGTTGAATAGAACCCTCTATGTAGTTATTAGCTATTTCTAAGATAACTACTTTAGC
AAGCCACAATACCCTATTTTAGACTATGAAAAAGTAAAATAATCAATAGCTTTGATTTTA
AATGAATTTTGTTTAATATTTAATCTTATTTAATCGATTAGGACTATGCACTCATTATCC
ATGAAATGCTTTTCGATGAATCTACTGATTTATCAATTTCTAAGACTTAAAAAGATTTTT
ATAAAGTGCTCTACGTAGCTCTCGCTTCATTCTCTGGTATCAATGTCAGAATTCCTTTCA
TAAAACCAGATAATCTTGATCAATGCAACGAAAGGGTAAAGCAATACCATAAATTCTATA
AAAGCTTTGAAAGCAAATTCATGTTTGAAGAGCTCTCAAATTGCCGTAACGAATTAACTG
ATTTATGCACCAAGTTACCTTCCTTGTTCCATCACACTAAGACAATATAAGTAAATTTAT
ATTTTTGACTTTTAAAAAATTTCATGATAAAAAATTAAAATAGGATGCTTCTCTTATTGA
ATTATATCAATACATAAGTCGTGAGTGCTTTGGAGAATCTTATTTAATTGAAGAAATTAA
AAGATCTAATGAAATGATTGATGGATTATGTGTTTTGAATGATTTCCATAGACCAAATCT
ATTCAATAATAGATTCAGTTTAGCCAGTGAGTGTATCACCTACTTAAATGAAAAGATAGA
TATGTTCTTCTTCTTAAATCCTTATTTAGGCAAATAGAAACTTTAATTATTTAACAGTTT
CTTTATTCTGTCATTCCACCCTACTTACTTATTCAGAATGTCAATTAGATTTGACCATGA
TTTAAACTTTTCTCTTACTGAAGATAACGAGTACGAGTCTATGCATAAGAAGGCCTTCTA
AATCATGAACAACTATATCTTTAAAGAAAATATTTTCTAAAAGGAAGCTACTCCCACTAT
AGAAAAAGTTTAAGAACTCTTGCTAACTAATCTTCGTATTGAGTCATTACAAAGATTCCC
ATGCTGCGCAGCTAATCCCGACTCTTTCTATTATATTTTCAATAGTGTAGAAATATTCGA
AATGTTAGATAAAAAAATTTGGTAGTAGAAAGTTATCGAATAAATAATGAAAACACTTAC
CGCCAACTATGAAGATGCTTATTTGTTTTCATAGCTTAGACCAAATGACATTAAAAAATG
CACAATTCCTCCTATTATTAAAAGCAATCCTTAATATTACGAGAGTTTGAAGACAATTAA
AATTGATAGAGACAGCATTTCACTTGAAAAAGCTAAAGCAGTTAGGGAAGCTTTCTTAGA
AATTATAAATAAATCAAACAATAAAATGGATGATCCAAAGACTCATTGGAAAACAAAGGT
TCTGTGTGGACTATTTGTTGTATACTTTTTAAATATCTTCGATGATTTGAACCACCCTTA
CATAGCTAGATTTGCTTAAATTTCTATTAATTTTGCTACAAGCAAGACTGACATTCATCT
AGCTTAATATGGAAGATCACTTCTTTTCAGATTAATTAACATAAATAAGAGAAGAGTTGT
TAAAAAAAATTATGAGCCTATGCCTGGCTTCTTTGGTCCTAGCATGGAGGTCGAAGATTC
TAATGATGGTGAGTATACCTTAGAGGAATTCTTTTAATATCATTTCTTAAAAAGAAAAGA
TTTACAATCGTACTTAATTAAATCAAGAGTAAAAATTAATTAAATTTTCAAAAAATAATC
AATCATTTTTATTTAATTTTTTAGGAAATCGGTACTTACTATGACTATGCTCCCCTCTAT
AATAAATCAGGCTACTAAATGAAAGAAAGCGATGGCATCTACTCCGAAACAATTATAAAA
ATTCTCTTAAATGAAAACTTCTTTAATGAATTTATTGAAACAATATTTGAAGCAAAAGAA
ATTTACTCAAGCGATAGTGATGAATAAGACCAAGAAAACCAACAAATAGATTTAAGCCAA
GGAGAAGTCTTCGATTAAATCTAAATTTTATTTAATTTCACTTTCGATTCAGATAAAAAG
AAATAAACCTTATTCAACATTAACCTTAATTTTAATTTATTCGAATTCTACGCACGTCTC
TTTAAGAAAATATTCTAGGCAGTTGGTATAATTTTTTTTTAAATATAAGAAAATAATCTA
AAAATGTTAATTTATTTAAATTAGGAAAAAGATTCTTTGATGCTACTCATAAAAAAATAG
AATCTCTTGCAGATGACTTTAACAATTTACCAAGATAAAGAGTGATTTCTATTTATGTTT
GGTCTATCTTAAAATGGATTTAACGTCTCTCTCGTGAAGAAAGAAAGCCTTATATGGATT
TCTGTGTTAATCTTACTTAAGAATGTATTGTTAATTGCTCATAAGAACTTTTTAGAGACT
GGTGCTTAAGTATATCACTTGCCTCTAAGAGTAATATATAAAACTAAAATAAATTTAATA
TCTTATTTATTTTTTTTATATTAAAAAGATAATTCATTTGATGTCATAGAAGAATTTGCT
TCAAGAATATTGGAAAAATTAAAACACTAAAAGGGTATAGGCAAAAGATTTAGATATCAT
AAACTTCTTAAAACTGTTTTAACATTAAATCAAACATGGGCTAGAAAGTATTGTTTAGAA
GGAATGAAGCTCATCATGGATGCTGATGTCGAAGATACTAAAGAAAGTGATGAAAATTGC
GAATTATTTGCCGAAATTCTTTGCTCATGCATCATAAGTAGAGTAAATGTTAAAAAACTC
AAGCAAGAAAAATGGATTAAAGAAGATCTTTAACAATTAATTGATGAGAAGAAACTTATC
GTTTAAGATGACTATACTGCTTTCGAAAATAATAAATTAATTACTCAGTTTATTGAGCAC
TTATTTAACAAGCTCAATAATGTAAAGAAAGAGTCAAAGAAAAAGCTCTACAGTCACATG
ACTTTCAAAGTACTTGATAGCATTTCTGTCAAACGTTAAAACGATCTCTTCTGGTCTTAC
TTCCGCCCATTCTTCACATATATTATTGACAACAAGGTAAATAAATATATTTTTAAAATC
TAGCTGAGATTAATTTATTTTTTTATACATAAAAGCCTGAGAATATAAACGAGATAGAAA
TATTGAAGGTTATGTCATGTAATGAGTATCCTGCTAATATAAGAAAGGATATCAAGAGAA
TTTTAGCTGAAAAAATTGAAAGTGAAAATTGGGTCAGTCGCCAAAAAGTAATTCTCTTCT
TAAAGGTAAACAAATTTCAGTATTAAAATGGAAATCATGATAATTTATTTTTTATTAGAA
CTTCTTATACTTTGAAGAATATTAAGAAAACTAAGTTTAAGTTGATAGTTTGATAATTAG
AGGCTTAACTGATAAGAATAATTCTGTTTCCTTGTTAGCTGTTGATTGCTTAAGTGAAAT
TCTCAAGCTTGCCACTACAGATGAATAAAATACTATCTTCTAAAAGTACAAATCTTAGTC
TCAATCTCTTCTTCCTAAAGACAAAAACTCTGAAGAATACAAATAACTTACTGATTAAAA
ATAAATTGCTGTTTAAGTTTTAATGTCTCTCCTTTTGGCCTTCTAAGAGGATATCCTCCC
CTGGACCGAGGAAGCCTTAAGAGAAGTTATTAACTCTAAAACATTAAATGCAAACATGAG
AAAAAAAGTAAAGGAATTTGTTGGGTAATATTGGAGAGAATAAGATGAAGTTATAACATT
TAATTCTTTATCTTTATCCGAAAAGATAAAGAAACAAATCAGAGAAATCGCTAACCCATA
CGATTATTTTGCATGA