Identifiers and Description

Gene Model Identifier

TTHERM_00151160

Standard Name

OXR1 (OXidation Resistance )

Aliases

PreTt20777 | 12.m00451 | 3700.m00171

Description

Protein of unknown function required for oxidative damage resistance

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00151160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05077.19.997093137033517e-262TLD family protein (660 aa)
OxytrichaContig1092.1.g732.000130478826482e-26TLD
WormBaseWBGene000187003.0000451088882257e-25locus:lmd-3 status:Confirmed
UniProt:H2L004 protein_id
:CCD70814.1
DictyBaseDDB_G02804135.00094715178354e-25DDB_G0280413 on chromosome: 3
position 3319399 to 3322888
SGDYPL196W4.998394530072393e-19OXR1 Protein of unknown functi
on required for normal levels
of resistance to oxidative dam
age, null mutants are sensitiv
e to hydrogen peroxide; member
of a conserved family of prot
eins found in eukaryotes
Stentor CoeruleusSteCoe_336040.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151160(coding)
ATGCTGAATGCTTTTAAGAACTTGCTTAGCTTTGGAGGTAGCAATAGCAACGGAAATTCC
AGTAATAAAGGATCAAGAAAATAGAGCAATAATTCATAAGGGAATCCTTCAGATGATAAT
ATAAGATATGAAGTCATTAATTTCGAAATTTAAGAAAATGAAAATATGCCTAGGGTAAAA
CAGTTTATAGGTAAAGTCGAAGAAGAAGAGATAGAAAATCAATCTCCTTAATTATTAAAG
AAGAGAAGTTAGAGTATGAATGTTAATAGCTCAAGTATAACGAGAAATAGTGAGCAATTT
AAAAGTATAGGGGCAAATCCAAGCGATCAAAAATAAGAAGATGATGAATCGAAATATATT
TTTTACACAACTACAAATTAAGATACACTTATAGGGCTATCTATAAAATTTAATATATCT
GAATAAAAAATCAAGCTTATAAATGATGTTTCTGATACTGTATTTCCAGGAATGAAACTT
AAATTTCCTAAAGAACTCTGCTAAAGCTAATCTACAGAAGATAGTACTATTGATGATACA
TACTAAATGAATAGAAGAAAAGCTTTGTCATTAAAAAAAGAACCTCAAGCTTCGTTATAA
AGCAGAATGGATTCAAACTAAGAAATTCATAGATTCCATTTCTACTACTGTACTCCCTAT
GGAAATATTATGGGTTGCTTATCAATTAATGATAGTGTTATTATGTTTGATCCGTCCCTT
TCAAATGCTACTAATATGCAGAAATTACAAAAGAAAAGAGTGATTAAATTTTAAGCATGT
ATAGATATTAAAGATATAAATGAGTCTACTGCTCTAGTGTTACCTCCAAGAGCATCTGAA
ATAACTAATGAAAATGCTAAAGAATATGTCCTACAAATATCTCTTAGTCATATAGGAAAC
AAAGATATCTATAAAAAATATAAAGATCGTCTTAAATAGCTCAAAAAAGAGAAAAAATCA
ATTTCAACAGTGTATTTCAGAGTATTTGAAAAGGATCATTTAGGAAATGATTTAAGTAAT
TAAGATAAGTAGTAAATAGTTCAATAAGTTGTAGAAATCATTAACAAAAATATTGAAAAC
TACTAAAAGAAAAAACAGGAATAAAAGCTTGAAGCTGATTTGCAAAAATCGAATAATAAC
TCTGACCAAACAAGCAGCAGCGAAGAAAAACATTTTAATAGAAGTTAAAGCAACCCAATT
ATTTCAAAAGCAAATAGTGACTTTGAAAGCATGTTATTAAACGATACAAAAACTCAAGAC
ACTAACATGACTTAATCACTTACACATGAGAAAAGCAAAGAAAAAGAAGATAAAAGCCAA
GAAAAGGAAGAATAGAAAGAGGGAAGTGATGAAGAATTTGAACAAGAAAGCTTAACTATT
TTACCATTTTTTGATATTTTATATGAAAATATTGTTCAAAAGAAAAAACTTACTACCTAA
GAAGCAGAATAAAATTAAATGAATTAATGGTTGACTCTTGAATTTGGTGCTAAGATGCTC
GAGCACTCCAATGTACTGACCCAGGAATTGTTTTTACAGATTATATATTATGTACCTTCT
ATGTTTAGATACACAAATTGGAGACTACTATACTCTAACATGAAGCATGGCATGAGTTTT
TAGACCCTGTATAGACATTGTGAAGAGGAGTCTCCAATATTTTTAGTTGTTTAAACCTTT
TAAGGAGAGAAATTTGGAGCTTACCTTTCTGACCCTCTTCATATTACTCATGCTTTTTAT
GGTAATGGAGAATGCTTTTTATTTAAATTTTAAGGAGAAGAATAAAAAATAAAAGCCTTT
TAACCTACTGGTAAAAACTAGCATTTTATCTTCTCAAATTCAGATGGATTAGGAGTTGGC
TGTGGTGAAAAATATGGATTATTTATAAATTGTGACCTATATAGAGGGTAGACTAACAAA
TGTGATACATTTGATAATGAAATTCTAAGCTCTGATGGAAAAGAATAGTTTAAAATAAAA
AACATAGAAATATGGGGTATAGACATGTGA


>TTHERM_00151160(protein)
MLNAFKNLLSFGGSNSNGNSSNKGSRKQSNNSQGNPSDDNIRYEVINFEIQENENMPRVK
QFIGKVEEEEIENQSPQLLKKRSQSMNVNSSSITRNSEQFKSIGANPSDQKQEDDESKYI
FYTTTNQDTLIGLSIKFNISEQKIKLINDVSDTVFPGMKLKFPKELCQSQSTEDSTIDDT
YQMNRRKALSLKKEPQASLQSRMDSNQEIHRFHFYYCTPYGNIMGCLSINDSVIMFDPSL
SNATNMQKLQKKRVIKFQACIDIKDINESTALVLPPRASEITNENAKEYVLQISLSHIGN
KDIYKKYKDRLKQLKKEKKSISTVYFRVFEKDHLGNDLSNQDKQQIVQQVVEIINKNIEN
YQKKKQEQKLEADLQKSNNNSDQTSSSEEKHFNRSQSNPIISKANSDFESMLLNDTKTQD
TNMTQSLTHEKSKEKEDKSQEKEEQKEGSDEEFEQESLTILPFFDILYENIVQKKKLTTQ
EAEQNQMNQWLTLEFGAKMLEHSNVLTQELFLQIIYYVPSMFRYTNWRLLYSNMKHGMSF
QTLYRHCEEESPIFLVVQTFQGEKFGAYLSDPLHITHAFYGNGECFLFKFQGEEQKIKAF
QPTGKNQHFIFSNSDGLGVGCGEKYGLFINCDLYRGQTNKCDTFDNEILSSDGKEQFKIK
NIEIWGIDM


>TTHERM_00151160(gene)
ATGCTGAATGCTTTTAAGAACTTGCTTAGCTTTGGAGTAATTAGCTATTTTTAAAATATT
TTTCTACAATATTATTCATTACTGTGATAGCAATTATTTATCTTTAGCTTCAAAATTTAT
CAATCTAGTCATGAATAATTATTTTTAAGATAAGAAATAGCTTAAACTTAAAATAAATCT
ATAATAATTCAAGTTATGAATAAACAATTAATTATTTTACTTTTTAATTTTAGGGTAGCA
ATAGCAACGGAAATTCCAGTAATAAAGGATCAAGAAAATAGAGCAATAATTCATAAGGGA
ATCCTTCAGATGATAATATAAGATATGAAGTCATTAATTTCGAAATTTAAGAAAATGAAA
ATATGCCTAGGGTAAAACAGTTTATAGGTAAAGTCGAAGAAGAAGAGATAGAAAATCAAT
CTCCTTAATTATTAAAGAAGAGAAGTTAGAGTATGAATGTTAATAGCTCAAGTATAACGA
GAAATAGTGAGCAATTTAAAAGTATAGGGGCAAATCCAAGCGATCAAAAATAAGAAGATG
ATGAATCGAAATATATTTTTTACACAACTACAAATTAAGATACACTTATAGGGCTATCTA
TAAAATTTAATATATCGTAAATTAATATATTTTAATTTGTTTAGCATATGTCAACTTTTT
TTCAAAATTACTATTTTAGTGAATAAAAAATCAAGCTTATAAATGATGTTTCTGATACTG
TATTTCCAGGAATGGTAATTTCTTTATATTAGATGATTAAATTCAATTTTTTTAACATAA
CCTAGAAACTTAAATTTCCTAAAGAACTCTGCTAAAGCTAATCTACAGAAGATAGTACTA
TTGATGATACATACTAAATGAATAGAAGAAAAGCTTTGTCATTAAAAAAAGAACCTCAAG
CTTCGTTATAAAGCAGAATGGATTCAAACTAAGAAATTCATAGATGTAAAAAAACCATAG
TCTATTATTAACTTTAAATTTCACTTTTTATAATAAAGTCCATTTCTACTACTGTACTCC
CTATGGAAATATTATGGGTTGCTTATCAATTAATGATAGTGTTATTATGTTTGATCCGTC
CCTTTCAAATGCTACTAATATGCAGAAATTACAAAGTTAGTTTATTAATGATAATTTTTT
AAGCAAAAGCTCACAAATTTTTATTTCTATTGAATAAATTTAGAGAAAAGAGTGATTAAA
TTTTAAGCATGTATAGATATTAAAGATATAAATGAGTCTACTGCTCTAGTGTTACCTCCA
AGAGCATCTGAAATAACTAATGAAAATGCTAAAGAATATGTCCTACAAATATCTCTTAGT
CATATAGGAAACAAAGATATCTATAAAAAATATAAAGATCGTCTTAAATAGCTCAAAAAA
GAGAAAAAATCAATTTCAACAGTGTATTTCAGAGTATTTGAAAAGGATCATTTAGGAAAT
GATTTAAGTAATTAAGATAAGTAGTAAATAGTTCAATAAGTTGTAGAAATCATTAACAAA
AATATTGAAAACTACTAAGTAATCTACTTTTAGTAAAAACAGTATTTTTATATTATTTTT
TATTGAATTACACAGAAGAAAAAACAGGAATAAAAGCTTGAAGCTGATTTGCAAAAATCG
AATAATAACTCTGACCAAACAAGCAGCAGCGAAGAAAAACATTTTAATAGAAGTTAAAGC
AACCCAATTATTTCAAAAGCAAATAGTGACTTTGAAAGCATGTTATTAAACGATACAAAA
ACTCAAGACACTAACATGACTTAATCACTTACACATGAGAAAAGCAAAGAAAAAGAAGAT
AAAAGCCAAGAAAAGGAAGAATAGAAAGAGGGAAGTGATGAAGAATTTGAACAAGAAAGC
TTAACTATTTTACCATTTTTTGATATTTTATATGAAAATATTGTTCAAAAGAAAAAACTT
ACTACCTAAGAAGCAGAATAAAATTAAATGAGTAAAATTTACTTTAATTTATTTACTTAA
ATATTTAAAAGAAAAATAATAAATAGATGTTGAAAGCTATTTCTTATTTTGTTAACTTAG
CTTGGATAAATTTTTTATCATTAAATAAATAATTATTTTTTTATAGATTAATGGTTGACT
CTTGAATTTGGTGCTAAGATGCTCGAGCACTCCAATGTACTGACCCAGGAATTGTTTTTA
CAGGTATAATAATTTTTTGTAAGAGTTAAATTGAAAATTAAAAAAATTTTTAAGATTATA
TATTATGTACCTTCTATGTTTAGATACACAAATTGGAGACTACTATACTCTAACATGAAG
CATGGCATGAGTTTTTAGACGTAAAATTAACAAATAAAAATAATATATTGAACTTATTTT
CTATTAATAGCCTGTATAGACATTGTGAAGAGGAGTCTCCAATATTTTTAGTTGTTTAAA
CCTTTTAAGGAGAGAAATTTGGAGCTTACCTTTCTGACCCTCTTCATATTACTCATGCTT
TTTATGGTAATGGAGAATGCTTTTTATTTAAATTTTAAGGAGAAGAATAAAAAATAAAAG
CCTTTTAACCTACTGGTAAAAACTAGCATTTTATCTTCTCAAATTCAGATGGATTAGGAG
TTGGCTGTGGTGAAAAATATGGATTATTTATAAATTGTGACCTATATAGAGGGTAGACTA
ACAAATGTGATACATTTGATAATGAAATTCTAAGCTCTGATGGAAAAGAATAGTTTAAAA
TAAAAAACATAGAAGTAAAGTTTAAAATAATATTAGCTAATTTGAAAATAATATTATTAA
TATAATTAATAGATATGGGGTATAGACATGTGA