Identifiers and Description

Gene Model Identifier

TTHERM_00684560

Standard Name

ORC2 (origin recognition complex subunit 2)

Aliases

PreTt18169 | 104.m00101 | 3732.m00015

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00466 ) ribosomal protein L10
  • ( PF02180 ) Bcl-2 homology region 4
  • ( PF04084 ) Origin recognition complex subunit 2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00684560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17345.16.002643599093603e-161hypothetical protein (754 aa)
OxytrichaContig6689.0.g113.998693556225637e-29Origin recognition complex sub
unit 2
DictyBaseDDB_G02698940.0000000000002999981760818895orcB on chromosome: 1 position
3810811 to 3812262
SGDYBR060C0.000000000029994712494008525ORC2 Subunit of the origin rec
ognition complex, which direct
s DNA replication by binding t
o replication origins and is a
lso involved in transcriptiona
l silencing; interacts with Sp
p1p and with trimethylated his
tone H3; phosphorylated by Cdc
28p
WormBaseWBGene000038820.00000019998969434520019locus:orc-2 Origin recogniti
on complex subunit 2 status:
Confirmed UniProt:Q21037 p
rotein_id:CAA85415.1

General Information

Paragraph NoGene NameParagraph Text
66ORC2Gene Information: TTHERM_00684560 against human ORC subunit 2 protein e-value= 8e-16 Reverse BLAST of NP_006181.1 against TGD: TTHERM_00684560 hypothetical protein e-value= 8e-15.
67ORC2The conserved Origin Recognition Complex (ORC) determines the sites for replication initiation in eukaryotic chromosomes and serves as a scaffold for pre-replicative complex (pre-RC) assembly. Although ORC subunits are conserved in eukaryotes, the cis-acting DNA sequence requirements for replicator function are not.
68ORC2Nucleic Acid Interactions: Orc2p bound to streptavidin sepharose in 26T RNA aptamer-tagged strains (TD152 and MM202, respectively)
69ORC2Protein Interaction Partners: Tetrahymena thermophila ORC physically associates with Orc1p in western blotting (native gel electrophoresis and immunoprecipitation analyses. Western blotting was similarly used to monitor the migration of nuclease-treated ORC complexes under native EMSA gel conditions. The mobility of Orc1p and Orc2p increased following MNase and RNase A treatment, but was unaltered by DNase I (Figure 3D). Orc1p and Orc2p co-migrated under all conditions, suggesting that they remain associated after the RNA is destroyed.
70ORC2Biochemical Activities: Consistent with previous analyses of Orc2p/Tt-p69 and histone H3 (Mohammad et al, 2003), ∼50% of Orc2 was rendered soluble by DNase I. TtORC also crossreacts with a rabbit polyclonal antibodies raised against Xenopus laevis / Orc2p.
71ORC2Regulation & Expression: Orc2p crossreactive subunit, Tt-p69, localizes to the macronucleus during vegetative S phase. Cell cycle regulated Maximal protein expression at G1/S border

Associated Literature

  1. Ref:18007594: Mohammad MM, Donti TR, Sebastian Yakisich J, Smith AG, Kapler GM (2007) Tetrahymena ORC contains a ribosomal RNA fragment that participates in rDNA origin recognition. The EMBO journal 26(24):5048-60
  2. Ref:12832485: Mohammad M, York RD, Hommel J, Kapler GM (2003) Characterization of a novel origin recognition complex-like complex: implications for DNA recognition, cell cycle control, and locus-specific gene amplification. Molecular and cellular biology 23(14):5005-17

Sequences

>TTHERM_00684560(coding)
ATGCAAAATAATTAACAGGAAAGATTGGAATTCTAGGAAAAATATGGTATTTAAAAGGAC
TATATTTCTTTATCCAAAGAAGATAAAAAGAAATAAGCTGCAGATGAAGTCATTGAGTTT
AACAATAAAAACTTGATTTCTTATTTAGAAGATAAATATTAAGTAGAAGACACTGAAAAA
GTAAAAGAAGACAAAGCTAAAGCAATTGTGAAATCATGTTTTATGATACAATCAGGATTT
AATGTTTGCTTACATGGTTATGGCTCTAAGAGACAAATTATTTAAGAAATATCAGATTAA
TTTATTAATTACCCTAAATTAATCATTTAAGGATATTCAGCAGCTACTTAAATATAGCAA
ATTCTATAAAAACTAAAGTACATTGTGGTAAAGATTACTGGGTAAAACTCTGGTTAAAAG
AGAATTGAAGGAATATTAGAGTATCTAAAATAATAAGAGGAAAATATGGGAAAAATTTCC
TCTTAAGTACCTTTTATTTTAATTCTATTTCATAATATAGATTCTAAATAATTTATTGAG
TAAGATTCTGTCAAAATTTTATCTGCTGTACTAAATTTACCATATATAAAAGCTGTTTGT
AGTATTGATCATGTGAAGTATCCAATTATTCTGACTTCTAAAGTTTTAGAGTCATTTAAT
TTTAGTTTCATAGAAGTCCATACTCATTAATGCTATCTACATGAATTCAAAGTTTCCTAA
AATACATTTAACTTAAAAAAAGAAAAAGAAGGAGAATCTCTTAAATATATTTTTAGAAGT
CTGACAAAAGTTTAAAAAGAAATAATATAGTTTGTTGCAAAATATATTTAAGATAAATTA
GATTAAAATCCAGGAACAGCTATTTAAATAAATGGATTAACTGAAGATGGATAGATTATT
GGTTTAACTTTAAAAGAGTTATTAGAAATGCTAATTGATGAAATGATTTTGAACAGTGAG
TAGCAGTTAAAAGAAAATTTACTTGAAATACTTGATCACAAAGTTATAATTTCAATAGAA
AACTAGTAAAAAACTTACTATACAATGAATTTCAGCAGACAAATTTTAGAAAAAATTGTC
AACAACAAGTTGGAGGATGGAGAAGAAGATTAGGAGCAGGAAGAAGAGGAAGAAAACAAT
TCAGTAAAAGATATGGAAGAAGAGAATTAAATAATATCTAACAGCTAAAACAGTTCTCAA
AGTGAAGATGAAGATGTTAAAGGTAAAAAAAAATATAGATAAACAAGAAGAGAAGGTAAA
AAGAAAAAAAATAGTAGTGAGAGCTTATCAGATTCAGAAAATGAAAAACATAAGTTTAAT
AAGAAAACTTCTGGAATTTTGAAAACTAAAAATAAGTAATAAAAGAATAAAAAAAGTAGC
TTTACTTCATAAAGTAGTGAAGAAGATGGTGATGATGATAGCTATTAAAATTGA


>TTHERM_00684560(protein)
MQNNQQERLEFQEKYGIQKDYISLSKEDKKKQAADEVIEFNNKNLISYLEDKYQVEDTEK
VKEDKAKAIVKSCFMIQSGFNVCLHGYGSKRQIIQEISDQFINYPKLIIQGYSAATQIQQ
ILQKLKYIVVKITGQNSGQKRIEGILEYLKQQEENMGKISSQVPFILILFHNIDSKQFIE
QDSVKILSAVLNLPYIKAVCSIDHVKYPIILTSKVLESFNFSFIEVHTHQCYLHEFKVSQ
NTFNLKKEKEGESLKYIFRSLTKVQKEIIQFVAKYIQDKLDQNPGTAIQINGLTEDGQII
GLTLKELLEMLIDEMILNSEQQLKENLLEILDHKVIISIENQQKTYYTMNFSRQILEKIV
NNKLEDGEEDQEQEEEEENNSVKDMEEENQIISNSQNSSQSEDEDVKGKKKYRQTRREGK
KKKNSSESLSDSENEKHKFNKKTSGILKTKNKQQKNKKSSFTSQSSEEDGDDDSYQN


>TTHERM_00684560(gene)
ATGCAAAATAATTAACAGGAAAGATTGGAATTCTAGGAAAAATATGGTATTTAAAAGGAC
TATATTTCTTTATCCAAAGAAGATAAAAAGAAATAAGCTGCAGATGAAGTCATTGAGTTT
AACAATAAAAACTTGATTTCTTATTTAGAAGATAAATATTAAGTAGAAGACACTGAAAAA
GTAAAAGAAGACAAAGCTAAAGCAATTGTGAAATCATGTTTTATGATACAATCAGGATTT
AATGTTTGCTTACATGGTTATGGCTCTAAGAGACAAATTATTTAAGAAATATCAGATTAA
TTTATTAATTACCCTAAATTAATCATTTAAGGATATTCAGCAGCTACTTAAATATAGCAA
ATTCTATAAAAACTAAAGTACATTGTGGTAAAGATTACTGGGTAAAACTCTGGTTAAAAG
AGAATTGAAGGAATATTAGAGTATCTAAAATAATAAGAGGAAAATATGGGAAAAATTTCC
TCTTAAGTACCTTTTATTTTAATTCTATTTCATAATATAGATTCTAAATAATTTATTGAG
TAAGATTCTGTCAAAATTTTATCTGCTGTACTAAATTTACCATATATAAAAGCTGTTTGT
AGTATTGATCATGTGAAGTATCCAATTATTCTGACTTCTAAAGTTTTAGAGTCATTTAAT
TTTAGTTTCATAGAAGTCCATACTCATTAATGCTATCTACATGAATTCAAAGTTTCCTAA
AATACATTTAACTTAAAAAAAGAAAAAGAAGGAGAATCTCTTAAATATATTTTTAGAAGT
CTGACAAAAGTTTAAAAAGAAATAATATAGTTTGTTGCAAAATATATTTAAGATAAATTA
GATTAAAATCCAGGAACAGCTATTTAAATAAATGGATTAACTGAAGATGGATAGATTATT
GGTTTAACTTTAAAAGAGTTATTAGAAATGCTAATTGATGAAATGATTTTGAACAGTGAG
TAGCAGTTAAAAGAAAATTTACTTGAAATACTTGATCACAAAGTTATAATTTCAATAGAA
AACTAGTAAAAAACTTACTATACAATGAATTTCAGCAGACAAATTTTAGAAAAAATTGTC
AACAACAAGTTGGAGGATGGAGAAGAAGATTAGGAGCAGGAAGAAGAGGAAGAAAACAAT
TCAGTAAAAGATATGGAAGAAGAGAATTAAATAATATCTAACAGCTAAAACAGTTCTCAA
AGTGAAGATGAAGATGTTAAAGGTAAAAAAAAATATAGATAAACAAGAAGAGAAGGTAAA
AAGAAAAAAAATAGTAGTGAGAGCTTATCAGATTCAGAAAATGAAAAACATAAGTTTAAT
AAGAAAACTTCTGGAATTTTGAAAACTAAAAATAAGTAATAAAAGAATAAAAAAAGTAGC
TTTACTTCATAAAGTAGTGAAGAAGATGGTGATGATGATAGCTATTAAAATTGA