Identifiers and Description

Gene Model Identifier

TTHERM_00865050

Standard Name

ORC1 (origin recognition complex subunit 1)

Aliases

PreTt29135 | 154.m00093 | 3751.m00439

Description

Largest subunit of the origin recognition complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00865050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19673.19.997093137033517e-262hypothetical protein (2343 aa)
OxytrichaContig20978.0.g1071.9997677415930956e-65ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02830739.995951036711152e-55orcA on chromosome: 4 position
182130 to 184025
WormBaseWBGene000126503.998097515166115e-39locus:orc-1 status:Partially
_confirmed UniProt:Q9XX17
protein_id:CAA21023.1
SGDYML065W1.0004783691736523e-35ORC1 Largest subunit of the or
igin recognition complex, whic
h directs DNA replication by b
inding to replication origins
and is also involved in transc
riptional silencing; exhibits
ATPase activity
Stentor CoeruleusSteCoe_369479.602680054508676e-24

General Information

Paragraph NoGene NameParagraph Text
61ORC1Gene Information: TTHERM_00865050 is a homolog of annotated and functionally characterized Orc1 in other experimental organisms (24% amino acid sequence identity, 49% similarity to human Orc1). Orc1 is a component of the heterohexameric origin recognition complex (ORC) found to be involved in initiation of DNA replication. TtOrc1 has canonical Walker A and B motifs (involved in ATP binding and hydrolysis). TtORC is unusual in that it contains an integral RNA subunit (26T RNA) that binds to its cognate DNA target in the ribosomal DNA (rDNA) replication origin.
62ORC1Nucleic Acid Interactions (with the ORC complex): 26T RNA (5’-AUGUCUAAGUGUGAUGAUAAACGAAAAAAAAUAAAAAUUAA-3’). Type I element T-rich strand: essential cis-acting replication determinant in ribosomal DNA origin of replication. (Location 5’ non-transcribed spacer) (C3 rDNA type IB element T-rich strand, T51: 5’-CTCAAAAGTTGCAAAAGTTCGGAAGGTTTACTATTTTTGTTTTTTTTTT-3’). – requires 26T RNA and ATP dsDNA – non rDNA chromosomes
63ORC1Protein Interaction Partners: TtOrc2 (Co-migration on a native gel, detection by WB).
64ORC1Biochemical Activities (of ORC complex): ATP binding, likely ATP hydrolysis DNA binding - typeI element T-rich strand DNA RNA binding – 26T RNA
65ORC1Regulation & Expression: mRNA and protein: Cell cycle regulated Maximal protein expression at G1/S border, degraded in S phase

Associated Literature

  1. Ref:19153611: Donti TR, Datta S, Sandoval PY, Kapler GM (2009) Differential targeting of Tetrahymena ORC to ribosomal DNA and non-rDNA replication origins. The EMBO journal 28(3):223-33
  2. Ref:18007594: Mohammad MM, Donti TR, Sebastian Yakisich J, Smith AG, Kapler GM (2007) Tetrahymena ORC contains a ribosomal RNA fragment that participates in rDNA origin recognition. The EMBO journal 26(24):5048-60
  3. Ref:12832485: Mohammad M, York RD, Hommel J, Kapler GM (2003) Characterization of a novel origin recognition complex-like complex: implications for DNA recognition, cell cycle control, and locus-specific gene amplification. Molecular and cellular biology 23(14):5005-17

Sequences

>TTHERM_00865050(coding)
ATGAACACAAGAAATACATAAAGGTCAATAGATCCAAAAAAAGGAAAGTAGCAATAAAAA
TCAGTTAGCAAAAGTAGAAGCAAAAGCAATAATATAACTTAAAGCAATGAAAAGATAAAA
AGGAGTTAAAGATTAAAGTCAAAAGATGAGATGATAGATTCGGTTTAAGAACCCAATATT
TTCGTCTAGAAAGATAAAAATAAACAATAATAATCTAAAAGTAAATCTAAGAATTCAACA
AAAGAATCAGAAAAAAAGCCTTAAAAAAGAGCATTTAAAATTGAGATACCTAAATAAAAT
GAATAAAAATTAAAAAAAACTTAAGAATCAAATAAAACAATAATAAATTTGACTAAATAG
TAGAAATAACAATTAAAATCATAATAGCTAACAAAAGCTGTAATTGAGTAATAAATACAC
ACTGAATCAAAGAAAAGGGAATACAATAAGCAAAAGAATAAAAATGATAATTTAGAAAAA
ACTAAAAATAATCATAATATTGTTACTATTGATTCCAGCAATGATGAAAATGAAAGTGAA
TATGAAATTTCAGATTGTCATATTTCAGTTTCTGTATATAATAATGATAATGAAATAGAT
ATAGATAAAAATGAATAGTCTGTAGATGTAAAGTAAAATAAAAATAAAAATATGATAGAT
AGTAGAGGAAGAAGTAAAAATAGCCTTAAAATTAAAAAAACATATTCTTCTAGCTAGTAA
AAGAGTTAAGAAAAATAGTAAGTTAAAGAATCAACTGCCAGCAAAAGGATTACTCGTAGC
CAATAAAATTTTGAACTTACAGAGTTATAAGATACAAAGGCAAAAAGTGCTTCAAAAAAC
AAAACAATAAATTCGGAAAAGCAAAATTAAAAAATGAATTCTAAAGAAAAAATTGATACA
AGCAAAGACAAGAATCCATCATTAATTGAAAGTGAAAAACCTAAAAGAGGAAGAAAGCCT
AAATAAGTAGAGATATTAAATGATAAAATTTAAGAAAAAGAGACAGATTAGTAAAAAACA
CCTAAAAAGAGGGGGAGAAAAAGTAAATAAGAAGCATTGTTAGATAGAAGAAACATTAAG
GAGATATAATAATAAAAAGAGTACGAAGAGAAATAATAAAAGAAATCTTCATCTAAAGAA
TCTTAAAAATTAACTCAAGCCAGCGAACATTTTAACTTTTAAGCGCTAATTTATTAATAA
AAACCCGCCAAAAAAGAGTTACGTATTGAAGACAAGAATTATTAAAAAATAAATGTTAAA
CCAAAACATAATATTTATGATTAAGCTATAGAAATGCTATAAGAATATTCATTGCCAGAA
GAAATTCCTTGTAGAGAAGATGAAAAGAAATAAATTTTAGAATTTATAAATGAAGGTTTA
GGCAATAATGGTAGCTCTAATTGCTTGTATATTTCAGGTGTTCCTGGTATAGGAAAGACA
GCAAGTTTTTTGGAAGTGATTAAAAAATTATAAAATGAAAAAAAAGATGAATTTACTTTC
ATTCACATTAATGCTATGAATTTAAGTAACCCAGAAAATTTATACTATATACTCGTTAAA
ACAATAACTGGGAAAAATTGCACATCAAAATAAAAAGCCTGTTAAATTTTAAATGAGCTT
TTCACTCGTGGAAAACTTTCAAAAACATACTAAAGCTATGGAGAAAATATTGATAATAAA
AATAAGGTGATTCTCTTAGATGAATTAGATTATTTAGTCACATAAGATTAGGATTTACTT
TATAACTTAATGGAATGGCCTCATCATAAATACTCAAAATTAACTATTATTGGGATAGCT
AATACTATGAATTTACCAGAAATTTTGATGAACAAAATTAAAAGTAGAATGGGAAGTAGA
AGACTTGTTTTTAATTAGTATAATCATAAATAAATACAGGAAATTATTGCTACTAGACTT
AAAAATTAGGAAAAAGTTAGGGAAGTGTTTGAGTAAAATGCAATAGAATATACATGCAGA
AAAATTGCTATTTCATCTTCAGATATAAGAAAAACATTGAAAGTGTTAAGAAAAGCTGTT
GAAATATGTCAGTTAGAAAACTTTTAAAATTAAAATGTTACAAAAGTAACTATTCCTATG
ATTTAAAAATCGTATAGCTAGTTATACTCTTCTCCTATTCTATATTCAATTTAAAAACTT
TAATTTCATCATAAGTTGATGATTCTTTCTATAGCTTTAGAAAATAAGCACAGAGGAATA
CCAGTAGCTTACTTGTCAGAGAGCTATAATAGATATAGAATAATGTTGAGCAATCTAGGT
AAAAACGAAACTATTAATTATAATCAAATGAAAATGGTCCTGAACTAACTTTCTGTTTTA
AATTTAATACAATTGAAGGAAAAAGAAATAGTTAAAGATACACAATTAATTGGTTTAGAT
CCTAATAAGAAACACTTTTGTCATGTTGTTGACATTTAAATTAATTCTAATTTTAGTGTT
GATGATGTCACTAACTCTCTAAAAGAAGATGAAATTTATTTGAAATTCTAACATTAATTC
TGA


>TTHERM_00865050(protein)
MNTRNTQRSIDPKKGKQQQKSVSKSRSKSNNITQSNEKIKRSQRLKSKDEMIDSVQEPNI
FVQKDKNKQQQSKSKSKNSTKESEKKPQKRAFKIEIPKQNEQKLKKTQESNKTIINLTKQ
QKQQLKSQQLTKAVIEQQIHTESKKREYNKQKNKNDNLEKTKNNHNIVTIDSSNDENESE
YEISDCHISVSVYNNDNEIDIDKNEQSVDVKQNKNKNMIDSRGRSKNSLKIKKTYSSSQQ
KSQEKQQVKESTASKRITRSQQNFELTELQDTKAKSASKNKTINSEKQNQKMNSKEKIDT
SKDKNPSLIESEKPKRGRKPKQVEILNDKIQEKETDQQKTPKKRGRKSKQEALLDRRNIK
EIQQQKEYEEKQQKKSSSKESQKLTQASEHFNFQALIYQQKPAKKELRIEDKNYQKINVK
PKHNIYDQAIEMLQEYSLPEEIPCREDEKKQILEFINEGLGNNGSSNCLYISGVPGIGKT
ASFLEVIKKLQNEKKDEFTFIHINAMNLSNPENLYYILVKTITGKNCTSKQKACQILNEL
FTRGKLSKTYQSYGENIDNKNKVILLDELDYLVTQDQDLLYNLMEWPHHKYSKLTIIGIA
NTMNLPEILMNKIKSRMGSRRLVFNQYNHKQIQEIIATRLKNQEKVREVFEQNAIEYTCR
KIAISSSDIRKTLKVLRKAVEICQLENFQNQNVTKVTIPMIQKSYSQLYSSPILYSIQKL
QFHHKLMILSIALENKHRGIPVAYLSESYNRYRIMLSNLGKNETINYNQMKMVLNQLSVL
NLIQLKEKEIVKDTQLIGLDPNKKHFCHVVDIQINSNFSVDDVTNSLKEDEIYLKFQHQF


>TTHERM_00865050(gene)
ATGAACACAAGAAATACATAAAGGTCAATAGATCCAAAAAAAGGAAAGTAGCAATAAAAA
TCAGTTAGCAAAAGTAGAAGCAAAAGCAATAATATAACTTAAAGCAATGAAAAGATAAAA
AGGAGTTAAAGATTAAAGTCAAAAGATGAGATGATAGATTCGGTTTAAGAACCCAATATT
TTCGTCTAGAAAGATAAAAATAAACAATAATAATCTAAAAGTAAATCTAAGAATTCAACA
AAAGAATCAGAAAAAAAGCCTTAAAAAAGAGCATTTAAAATTGAGATACCTAAATAAAAT
GAATAAAAATTAAAAAAAACTTAAGAATCAAATAAAACAATAATAAATTTGACTAAATAG
TAGAAATAACAATTAAAATCATAATAGCTAACAAAAGCTGTAATTGAGTAATAAATACAC
ACTGAATCAAAGAAAAGGGAATACAATAAGCAAAAGAATAAAAATGATAATTTAGAAAAA
ACTAAAAATAATCATAATATTGTTACTATTGATTCCAGCAATGATGAAAATGAAAGTGAA
TATGAAATTTCAGATTGTCATATTTCAGTTTCTGTATATAATAATGATAATGAAATAGAT
ATAGATAAAAATGAATAGTCTGTAGATGTAAAGTAAAATAAAAATAAAAATATGATAGAT
AGTAGAGGAAGAAGTAAAAATAGCCTTAAAATTAAAAAAACATATTCTTCTAGCTAGTAA
AAGAGTTAAGAAAAATAGTAAGTTAAAGAATCAACTGCCAGCAAAAGGATTACTCGTAGC
CAATAAAATTTTGAACTTACAGAGTTATAAGATACAAAGGCAAAAAGTGCTTCAAAAAAC
AAAACAATAAATTCGGAAAAGCAAAATTAAAAAATGAATTCTAAAGAAAAAATTGATACA
AGCAAAGACAAGAATCCATCATTAATTGAAAGTGAAAAACCTAAAAGAGGAAGAAAGCCT
AAATAAGTAGAGATATTAAATGATAAAATTTAAGAAAAAGAGACAGATTAGTAAAAAACA
CCTAAAAAGAGGGGGAGAAAAAGTAAATAAGAAGCATTGTTAGATAGAAGAAACATTAAG
GAGATATAATAATAAAAAGAGTACGAAGAGAAATAATAAAAGAAATCTTCATCTAAAGAA
TCTTAAAAATTAACTCAAGCCAGCGAACATTTTAACTTTTAAGCGCTAATTTATTAATAA
AAACCCGCCAAAAAAGAGTTACGTATTGAAGACAAGAATTATTAAAAAATAAATGTTAAA
CCAAAACATAATATTTATGATTAAGCTATAGAAATGCTATAAGAATATTCATTGCCAGAA
GAAATTCCTTGTAGAGAAGATGAAAAGAAATAAATTTTAGAATTTATAAATGAAGGTTTA
GGCAATAATGGTAGCTCTAATTGCTTGTGTAATCAATTAATTTTAAATTCTTTTTAAATT
TTCATAAAATTTAAAAAAATTTATTAATCATAAATTAAAAATTTAGATATTTCAGGTGTT
CCTGGTATAGGAAAGACAGCAAGTTTTTTGGAAGTGATTAAAAAATTATAAAATGAAAAA
AAAGATGAATTTACTTTCATTCACATTAATGCTATGAATTTAAGTAACCCAGAAAATTTA
TACTATATACTCGTTAAAACAATAACTGGGAAAAATTGCACATCAAAATAAAAAGCCTGT
TAAATTTTAAGTAAGCAATTAATTTATTAATACTTAAAAAATTAATTTATTGTTTTAATT
TTATTAGATGAGCTTTTCACTCGTGGAAAACTTTCAAAAACATACTAAAGCTATGGAGAA
AATATTGATAATAAAAATAAGTAATTTTTGACTAAAAAATAATAAAACTATATTTAAAAT
ACTATTTTAATTAAATTCAGGGTGATTCTCTTAGATGAATTAGATTATTTAGTCACATAA
GATTAGGATTTACTTTATAACTTAATGGAATGGCCTCATCATAAATACTCAAAATTAACT
ATTATTGGGATAGCTAATACTATGAATTTACCAGAAATTTTGATGAACAAAATTAAAAGT
AGAATGGGAAGTAGAAGACTTGTTTTTAATTAGTATAATCATAAATAAATACAGGAAATT
ATTGCTACTAGACTTAAAAATTAGGAAAAAGTTAGGGAAGTGTTTGAGTAAAATGCAATA
GAATATACATGCAGAAAAATTGCTATTTCATCTTCAGATATAAGAAAAACATTGAAAGTG
TTAAGAAAAGCTGTTGAAATATGTCAGTTAGAAAACTTTTAAAATTAAAATGTTACAAAA
GTAACTATTCCTATGATTTAAAAATCGTATAGCTAGTTATACTCTTCTCCTATTCTATAT
TCAATTTAAAAACTTTAATTTCATCATAAGTTGATGATTCTTTCTATAGCTTTAGAAAAT
AAGCACAGAGGAATACCAGTAGCTTACTTGTCAGAGGTAAATATTTAAATTCTAAATTTA
TATAATTTTTATTTATATATTTATGATATAGAGCTATAATAGATATAGAATAATGTTGAG
CAATCTAGGTAAAAACGAAACTATTAATTATAATCAAATGAAAATGGTCCTGAACTAACT
TTCTGTTTTAAATTTAATACAATTGAAGGAAAAAGAAATAGTTAAAGATACACAATTAAT
TGGTTTAGATCCTAATAAGAAACACTTTTGTCATGTTGTTGACATTTAAATTAATTCTAA
TTTTAGTGTTGATGATGTCACTAACTCTCTAAAAGAAGATGAAATTTATTTGAAATTCTA
ACATTAATTCTGA