Identifiers and Description

Gene Model Identifier

TTHERM_00052620

Standard Name

OLE2 (OLEic acid requiring)

Aliases

PreTt11442 | 3.m01841 | 3824.m03196

Description

Fatty acid desaturase family protein; paralog of OLE1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00052620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01505.19.997093137033517e-262fatty acid desaturase (309 aa)
WormBaseWBGene000013989.999776257620412e-83locus:fat-6 Delta(9)-fatty-a
cid desaturase fat-6 status:
Partially_confirmed UniProt:
G5EGN2 protein_id:CAB08356.1
DictyBaseDDB_G02888012.9994376937714457e-52scdA on chromosome: 5 position
1982434 to 1984703
SGDYGL055W8.001824328206442e-49OLE1 Delta(9) fatty acid desat
urase, required for monounsatu
rated fatty acid synthesis and
for normal distribution of mi
tochondria

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052620(coding)
ATGCAAGTTTCAGTAAAAAAACACTAAAACTCTACTGAGGGCAAAATCAAGGAGTTTGCT
CACAAAGAAAATACTAAAAATGATCCAATTCAAGAAAAAGAAGAAATAAGAGTTCCTGAG
AGCATTTTTTTAGGAATCATGCATGTTCTTGCTTTTGCTGGTTTGATACTACTATTTACC
TATGATAAATAGACAATAATTAGATCTTTGTGCCTTATGGGTTTTCTCCATTACTTAAGT
TGCTTGGGTATTGGATCTGGAGTTCACAGACTTTGGGCTCATCGTTCTTATAAAGCAAGT
ACTCCATACCGTGTTTTGTTGATGATTTTACAATCACTTGCATTTTAAGGGAGCATTTTC
CATTGGTCTAGAGATCACAGATTGCACCACAAGTTCTCAGACACTGATTTAGATCCTCAC
TCTATGAATAGAGGATTCTTCTTTGCTCATATGGGGTGGCTTTTGGTTAAGAAGAGCAAA
GCTTTAGTAGATGAAGGTTACAAAATTGATGTCTAGGATCTTTTAAATGACCCTGTTGTT
AAATTCCAAAAGAAAAACTATTACAAGCTCTCAACATTAATTTGTTTTATTATTCCAACC
ATTTTAAGCTACTTTATTGTTGGAGGAAGCCTTATTTTTGGATTCTTAACTGCTGGTGTT
TTTAGATATATTTTCATGCTCCACGTTACTTGGTGTGTAAATTCAGTTTGCCACATGTTT
GGAACAAGACCTTACAACCCTGATATTTTACCTACTGAAAACTTGTTTGTTTCTATTTTT
GCTTGCGGTGAAGGATGGCATAATTGGCACCATGAATACCCTAGAGACTGGAGAGCTTGC
GAAAACAAATGGTATAAGTGGAATCCTAATGGCTGGTTTATATAAATTGCTGAATTACTT
GGCTTTGCAAATACACATTTGGAAAAGGCATAATGA


>TTHERM_00052620(protein)
MQVSVKKHQNSTEGKIKEFAHKENTKNDPIQEKEEIRVPESIFLGIMHVLAFAGLILLFT
YDKQTIIRSLCLMGFLHYLSCLGIGSGVHRLWAHRSYKASTPYRVLLMILQSLAFQGSIF
HWSRDHRLHHKFSDTDLDPHSMNRGFFFAHMGWLLVKKSKALVDEGYKIDVQDLLNDPVV
KFQKKNYYKLSTLICFIIPTILSYFIVGGSLIFGFLTAGVFRYIFMLHVTWCVNSVCHMF
GTRPYNPDILPTENLFVSIFACGEGWHNWHHEYPRDWRACENKWYKWNPNGWFIQIAELL
GFANTHLEKAQ


>TTHERM_00052620(gene)
ATGCAAGTTTCAGTAAAAAAACACTAAAACTCTACTGAGGGCAAAATCAAGGAGTTTGCT
CACAAAGAAAATACTAAAAATGATCCAATTCAAGAAAAAGAAGAAATAAGAGTTCCTGAG
AGCATTTTTTTAGGAATCATGCATGTTCTTGCTTTTGCTGGTTTGATACTACTATTTACC
TATGATAAATAGACAATAATTAGATCTTTGTGCCTTATGGGTTTTCTCCATTACTTAAGT
TGCTTGGGTATTGGATCTGGAGTTCACAGACTTTGGGCTCATCGTTCTTATAAAGCAAGT
ACTCCATACCGTGTTTTGTTGATGATTTTACAATCACTTGCATTTTAAGGGAGCATTTTC
CATTGGTCTAGAGATCACAGATTGCACCACAAGTTCTCAGACACTGATTTAGATCCTCAC
TCTATGAATAGAGGATTCTTCTTTGCTCATATGGGGTGGCTTTTGGTTAAGAAGAGCAAA
GCTTTAGTAGATGAAGGTTACAAAATTGATGTCTAGGATCTTTTAAATGACCCTGTTGTT
AAATTCCAAAAGAAAAACTATTACAAGCTCTCAACATTAATTTGTTTTATTATTCCAAGT
AAAATATTTTACCATTCATTTTAAATTTCTTGCACATAACCAAATATAGAAAAAAAGGAG
TTAAACAAATAAAAAACAAATTAATTAAAATTCAACTTTTACTGTTTACAGATTATTACT
TTTAATTACTTGAAAAATAATGTAAATATCTTTATTAACCCAAATTAAATTTATAAAAAG
CCATTTTAAGCTACTTTATTGTTGGAGGAAGCCTTATTTTTGGATTCTTAACTGCTGGTG
TTTTTAGATATATTTTCATGCTCCACGTTACTTGGTGTGTAAATTCAGTTTGCCACATGT
TTGGAACAAGACCTTACAACCCTGATATTTTACCTACTGAAAACTTGTTTGTTTCTATTT
TTGCTTGCGGTGAAGGATGGCATAATTGGCACCATGAATACCCTAGAGACTGGAGAGCTT
GCGAAAACAAATGGTATAAGTGGAATCCTAATGGCTGGTTTATATAAATTGCTGAATTAC
TTGGCTTTGCAAATACACATTTGGAAAAGGCATAATGA