Identifiers and Description

Gene Model Identifier

TTHERM_00463280

Standard Name

OLE1 (OLEic acid requiring)

Aliases

PreTt25780 | 54.m00236 | 3823.m01147

Description

Putative fatty acid desaturase; mRNA expression and stability increases upon decreased temperature; sequence similarity to delta-9-acyl-CoA desaturases from yeast, rat, and mouse

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00463280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10724.19.997093137033517e-262fatty acid desaturase (293 aa)
WormBaseWBGene000013989.99562814099401e-84locus:fat-6 Delta(9)-fatty-a
cid desaturase fat-6 status:
Partially_confirmed UniProt:
G5EGN2 protein_id:CAB08356.1
DictyBaseDDB_G02738375.001636743996964e-56scdB-2 on chromosome: 2 positi
on 3466919 to 3469700
SGDYGL055W5.0007856079333316e-54OLE1 Delta(9) fatty acid desat
urase, required for monounsatu
rated fatty acid synthesis and
for normal distribution of mi
tochondria

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10735176: Nakashima S, Nozawa Y (1999) Stress-responsive gene expression in Tetrahymena. Acta biologica Hungarica 50(4):413-24
  2. Ref:8694777: Nakashima S, Zhao Y, Nozawa Y (1996) Molecular cloning of delta 9 fatty acid desaturase from the protozoan Tetrahymena thermophila and its mRNA expression during thermal membrane adaptation. The Biochemical journal 317 ( Pt 1)( ):29-34

Sequences

>TTHERM_00463280(coding)
ATGAACGTTAAAAATAAAATTAAATTAAAGTAAAATAAAATAAAAAAAATATACAAATAG
AATAAACTCACTCACACATACACACAAATGGGAGTATACTCTAAAGGTGAATTCAAGGTC
ATGGGTTATGAACTCAAGAAAGAGTATTGCATATGGTTAGGTTATATGCACATACTTGCT
GTAGCTGGTCTTATCTACTGGCTTTTATAAGAAAAGGAATTGTTCACAAAGAGTCTTTAC
ATGTTCCTTATTTTCCACTTGATGGGAGGTTTAGGTATTACTGCTGGCTCACATCGTCTC
TGGGCTCACAGAAGTTACACTGCCAAGACTCCCTACAGAATTTTGGTTATGCTCTTTAAC
AGCATGGCCTTCTAAGGTTCTATTTTCCACTGGAGCAGAGACCACAGACTCCACCATAAA
TTCTCGGACACAGATATTGATCCTCACTCAATGAACAAGGGATTCTTCTTTGCTCACGTT
GGCTGGTTACTTGTCAAGAAATCTCCTGAACTTAAAAAGGAAGGTGAAAAATTGAATATT
TAGGATCTTAAGGATGACCCTGTTGTTATGTTCCAAAAGAAGCACTACTTCTTGATTTCT
ACATTGGTCTGCTTTGTTATTCCAACTGTCATTATGCAATACACCATTGGAGGAGGATTC
ATCTACAACTTTTTGATGAGCTGTTTCAGATACGTCTTTATGCTTCACACTACCTGGTGT
GTAAACAGTGTATGCCACATGTTTGGTAGCAGACCTTATAACGAGTCTATTTTACCCACT
GAAAACCTCTTCGTTAGTATTATTGCTCTCGGTGAAGGATGGCACAACTGGCATCACGAA
TACCCCAGAGATTGGAGAGCTGCCGAAAATAAATGGACTAAGATCAACTTTACTTCCGGC
TTTATCAAGTTCTTCGAATTTTTGGGTCAATGTGATACCAATGGAATTAAGAAAAACGAA
TCTTGA


>TTHERM_00463280(protein)
MNVKNKIKLKQNKIKKIYKQNKLTHTYTQMGVYSKGEFKVMGYELKKEYCIWLGYMHILA
VAGLIYWLLQEKELFTKSLYMFLIFHLMGGLGITAGSHRLWAHRSYTAKTPYRILVMLFN
SMAFQGSIFHWSRDHRLHHKFSDTDIDPHSMNKGFFFAHVGWLLVKKSPELKKEGEKLNI
QDLKDDPVVMFQKKHYFLISTLVCFVIPTVIMQYTIGGGFIYNFLMSCFRYVFMLHTTWC
VNSVCHMFGSRPYNESILPTENLFVSIIALGEGWHNWHHEYPRDWRAAENKWTKINFTSG
FIKFFEFLGQCDTNGIKKNES


>TTHERM_00463280(gene)
ATGAACGTTAAAAATAAAATTAAATTAAAGTAAAATAAAATAAAAAAAATATACAAATAG
AATAAACTCACTCACACATACACACAAATGGGAGTATACTCTAAAGGTGAATTCAAGGTC
ATGGGTTATGAACTCAAGAAAGAGTATTGCATATGGTTAGGTTATATGCACATACTTGCT
GTAGCTGGTCTTATCTACTGGCTTTTATAAGAAAAGGAATTGTTCACAAAGAGTCTTTAC
ATGTTCCTTATTTTCCACTTGATGGGAGGTTTAGGTATTACTGCTGGCTCACATCGTCTC
TGGGCTCACAGAAGTTACACTGCCAAGACTCCCTACAGAATTTTGGTTATGCTCTTTAAC
AGCATGGCCTTCTAAGGTTCTATTTTCCACTGGAGCAGAGACCACAGACTCCACCATAAA
TTCTCGGACACAGATATTGATCCTCACTCAATGAACAAGGGATTCTTCTTTGCTCACGTT
GGCTGGTTACTTGTCAAGAAATCTCCTGAACTTAAAAAGGAAGGTGAAAAATTGAATATT
TAGGATCTTAAGGATGACCCTGTTGTTATGTTCCAAAAGAAGCACTACTTCTTGATTTCT
ACATTGGTCTGCTTTGTTATTCCAAGTAATTTTTTTTCTTTTATAAATACAAAAAAATTA
TAATAAATTTTGCCAATCGCGAAAACAAACAAACAAACAAACAATCTATAAATAAATTAT
CAATTTACTTAGTCATTTGCATAAATGGCTGTTAAGAAATTGAAACAATAAAAAGTGTTC
ATAAATCCAAATTTAAAATGAATTTTGATAAAAAAGCTTGTTAAAAAAAATCATTTTGAT
TCATTAATTAATTTATGCCAGTTTAAATATTCTAGAAAACTAATTTTTATTAAGCTAAAT
ATTCTAAACATCAATTTAATATTTAATAGCTGTCATTATGCAATACACCATTGGAGGAGG
ATTCATCTACAACTTTTTGATGAGCTGTTTCAGATACGTCTTTATGCTTCACACTACCTG
GTGTGTAAACAGTGTATGCCACATGTTTGGTAGCAGACCTTATAACGAGTCTATTTTACC
CACTGAAAACCTCTTCGTTAGTATTATTGCTCTCGGTGAAGGATGGCACAACTGGCATCA
CGAATACCCCAGAGATTGGAGAGCTGCCGAAAATAAATGGACTAAGATCAACTTTACTTC
CGGCTTTATCAAGTTCTTCGAATTTTTGGGTCAATGTGATACCAATGGAATTAAGAAAAA
CGAATCTTGA