Identifiers and Description

Gene Model Identifier

TTHERM_01243450

Standard Name

OGL1 (OGG1-Like)

Aliases

PreTt01756 | 287.m00027

Description

HhH-GPD superfamily base excision DNA repair protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00633 ) Helix-hairpin-helix motif
  • ( TIGR00588 ) 8-oxoguanine DNA-glycosylase (ogg)
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF07934 ) 8-oxoguanine DNA glycosylase, N-terminal domain
  • ( PF00730 ) base excision DNA repair protein,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01243450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10178.19.997093137033517e-262HhH-GPD superfamily base excis
ion DNA repair protein (378 aa
)
OxytrichaContig9033.0.g1131.0004671766404936e-768-oxoguanine DNA glycosylase,
N-terminal domain
DictyBaseDDB_G02926185.001636743996964e-56ogg1 on chromosome: 6 position
1847428 to 1848747
SGDYML060W1.000159011384939e-43OGG1 Mitochondrial glycosylase
/lyase that specifically excis
es 7,8-dihydro-8-oxoguanine re
sidues located opposite cytosi
ne or thymine residues in DNA,
repairs oxidative damage to m
itochondrial DNA, contributes
to UVA resistance

General Information

Paragraph NoGene NameParagraph Text
88OGL1Tetrahymena thermophila’s OGL1 protein is homologous to proteins from the HhH-GPD and OGG-N superfamilies, which are associated with DNA repair. It contains two domains; the first domain (E-value= 3.0 -17), in the HhH-GPD family, is a Helix-hairpin-helix and Gly/Pro rich loop, found on proteins that remove base lesions. The second domain (E-value=6.9-13), is common to oxoguanine gylcosylases, also known as OGG1, which removes 8-oxoG lesions. The closest homologs are in Scheffersomyces stipitis, a negative Crabtree yeast, and in Taphrina deformans, a fungi/plant pathogen, with 46% identical residues. OGL1 may be an essential protein in preventing mutations in DNA that lead to a short lifespan, early aging, and cancer. Paragraph by: Lillian Horin, Maite Cortes Garcia, Francis Ryu, Forrest Fulgenzi, Keck Science Center, Pitzer College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01243450(coding)
ATGAAGTCTCTAATAAACCCCTTAACTAAAAAGCCAATAACATAGATAGAATTCAATTTA
AAGAATACCTTGGTCAACGGCCAAGCATTTAATTGGATAAACAAAGATGTAACTTATAAC
AAAGAGTTTAGAGGGATTCTAGGTAAAAATGTAGTAGATTTTAAAGTTAATGAAAATAAT
GAAGTAATGTACAAAGAAATACCAGAAAATTCAAAAATTGAGGAGATTATTAATGATTAC
TTGCAATTAAATGTAGATTTAGTCAAGCTTACTGTTGAGTGGTCAGAAAAAGATAACTAT
TATGCTAAAGTCAAAGAATAGTTAAAAGGAGTTCGTATCTTGAGATAGTTTCCATTTGAG
TGCATGATTAGCTTTATATGTTCCTAAAACAATAATATTCCAAGAATTACTAAAATTTTA
AAAAGTTTGAGATAGAATTTTGGAGAGGAAATTTATAGAGAAAAATTAGAAGATGGTAGC
GAAGAAATTTATTATAGTTTTCCATCTGTAGCATCATTGAGGAAAGCAACAGAACAAAAT
CTCAGAGATTTGGGATTGGGTTATAGAGCTAATTATATTGTCTCAGCAGTTTAGCTACTT
GAGGAGAAAGGAGGAGAAGAATATTTGCACAAATTGCGCTAGCTGAAAGATTCACATGAG
AAAAGAGAAGCCCTGCTTGAATTCAAAGGAATAGGAAATAAAGTAGCAGATTGTATATCT
CTCTTTAGCTTAGATGCAAAAGATTTAATCCCTGTAGATACTCATGTTTTTCAAATATAT
AATAGAGTTTACAAAAAAAATAAAAACAAAGATAAAAAAATGACAAAAGATCAGTATTCA
GAAATAGAAAATTTCTTTAAAGATCTATATGGAGATTATGCAGGATGGGCCCATCAAGCT
ATTTTTGCGGCTGAACTCGTCTCTTTTTAGTCAGAAATTAACTCAAACGAAAACTCTTCA
GTAAAAAAAACAAAATCATCAAAATTACAAGAGGAAAAAGAATAAGAAAAAGAATAAACT
ACAGAGGAGTAAAAAATTATTTCTAAAAGTAAAATTAGCGAATAAACATCTTCAGAGAAA
AATAAAAGAAATTAAAACAAAAAAATAAAGTGA


>TTHERM_01243450(protein)
MKSLINPLTKKPITQIEFNLKNTLVNGQAFNWINKDVTYNKEFRGILGKNVVDFKVNENN
EVMYKEIPENSKIEEIINDYLQLNVDLVKLTVEWSEKDNYYAKVKEQLKGVRILRQFPFE
CMISFICSQNNNIPRITKILKSLRQNFGEEIYREKLEDGSEEIYYSFPSVASLRKATEQN
LRDLGLGYRANYIVSAVQLLEEKGGEEYLHKLRQLKDSHEKREALLEFKGIGNKVADCIS
LFSLDAKDLIPVDTHVFQIYNRVYKKNKNKDKKMTKDQYSEIENFFKDLYGDYAGWAHQA
IFAAELVSFQSEINSNENSSVKKTKSSKLQEEKEQEKEQTTEEQKIISKSKISEQTSSEK
NKRNQNKKIK


>TTHERM_01243450(gene)
ATGAAGTCTCTAATAAACCCCTTAACTAAAAAGCCAATAACATAGATAGAATTCAATTTA
AAGAATACCTTGGTCAACGGCCAAGCATTTAATTGGATAAACAAAGATGTAACTTATAAC
AAAGAGTTTAGAGGGATTCTAGGTAAAAATGTAGTAGATTTTAAAGTAAAATTAAATGAA
AATTATTTTCATAATAAACATAATTAAAATCAAAAATTTAATGAAAGGTTAATGAAAATA
ATGAAGTAATGTACAAAGAAATACCAGAAAATTCAAAAATTGAGGAGATTATTAATGATT
ACTTGCAATTAAATGTAGATTTAGTCAAGCTTACTGTTGAGTGGTCAGAAAAAGATAACT
ATTATGCTAAAGTCAAAGAATAGTTAAAAGGAGTTCGTATCTTGAGATAGTTTCCATTTG
AGTGCATGATTAGCTTTATATGTTCCTAAAACAATAATATTCCAAGAATTACTAAAATTT
TAAAAAGTTTGAGATAGAATTTTGGAGAGGAAATTTATAGAGAAAAATTAGAAGATGGTA
GCGAAGAAATTTATTATAGTTTTCCATCTGTAGCATCATTGAGGAAAGCAACAGAACAAA
ATCTCAGAGATTTGGGATTGGGTTATAGAGCTAATTATATTGTCTCAGCAGTTTAGCTAC
TTGAGGAGAAAGGAGGAGAAGAATATTTGCACAAATTGCGCTAGCTGAAAGATTCACATG
AGAAAAGAGAAGCCCTGCTTGAATTCAAAGGAATAGGAAATAAAGTAGCAGATTGTATAT
CTCTCTTTAGCTTAGATGCAAAAGATTTAATCCCTGTAGATACTCATGTTTTTCAAATAT
ATAATAGAGTTTACAAAAAAAATAAAAACAAAGATAAAAAAATGACAAAAGATCAGTATT
CAGAAATAGAAAATTTCTTTAAAGATCTATATGGAGATTATGCAGGATGGGCCCATCAAG
CTATTTTTGCGGCTGAACTCGTCTCTTTTTAGTCAGAAATTAACTCAAACGAAAACTCTT
CAGTAAAAAAAACAAAATCATCAAAATTACAAGAGGAAAAAGAATAAGAAAAAGAATAAA
CTACAGAGGAGTAAAAAATTATTTCTAAAAGTAAAATTAGCGAATAAACATCTTCAGAGA
AAAATAAAAGAAATTAAAACAAAAAAATAAAGTGA